DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Hnrnpa1

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001034218.1 Gene:Hnrnpa1 / 15382 MGIID:104820 Length:373 Species:Mus musculus


Alignment Length:211 Identity:52/211 - (24%)
Similarity:86/211 - (40%) Gaps:26/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 EEASTVFVGNLPINTKRVQLVKLFQPYG-LVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVLEKP 215
            |:...:|:|.|...|....|...|:.:| |...:.:|....|       |........|..:|:.
Mouse    11 EQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTK-------RSRGFGFVTYATVEEV 68

  Fly   216 EIAQQALALNGSEFKENHLRVTPASMAEKFGQAKDKQ-PSDKDAKRTIFVGSLKYSATEEQLREI 279
            :     .|:|....|.:...|.|.....:    :|.| |......:.||||.:|....|..||:.
Mouse    69 D-----AAMNARPHKVDGRVVEPKRAVSR----EDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDY 124

  Fly   280 FSSCGEIDYIRCLQDGDKGCK-GVAYVCFQKPDAVG-LALELNQTLLDDRPINVERYQVKKLGAK 342
            |...|:|:.|..:.|...|.| |.|:|.|...|:|. :.::...|      :|....:|:|..:|
Mouse   125 FEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHT------VNGHNCEVRKALSK 183

  Fly   343 QVRDAAAASAASKTSS 358
            |...:|::|...::.|
Mouse   184 QEMASASSSQRGRSGS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 16/82 (20%)
RRM_SF 261..332 CDD:302621 23/72 (32%)
Hnrnpa1NP_001034218.1 RRM1_hnRNPA1 12..92 CDD:241205 18/91 (20%)
RRM2_hnRNPA1 105..181 CDD:241024 25/81 (31%)
HnRNPA1 310..345 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.