DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and HNRNPA1L2

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001011724.1 Gene:HNRNPA1L2 / 144983 HGNCID:27067 Length:320 Species:Homo sapiens


Alignment Length:275 Identity:63/275 - (22%)
Similarity:102/275 - (37%) Gaps:46/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 NANNKDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQPYG-LVQSIRLRTAGGKQLFKHK 198
            :|:.|:.|.::::          |:|.|...|....|...|:.:| |...:.:|....|      
Human     4 SASPKEPEQLRKL----------FIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTK------ 52

  Fly   199 QRKVAGSLNAYVVLEKPEIAQQALALNGSEFKENHLRVTPASMAEKFGQAKDKQ-PSDKDAKRTI 262
             |........|..:|:.:     .|:|.:..|.:...|.|.....:    :|.| |......:.|
Human    53 -RSRGFGFVTYATVEEVD-----AAMNTTPHKVDGRVVEPKRAVSR----EDSQRPGAHLTVKKI 107

  Fly   263 FVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCK-GVAYVCFQKPDAVGLALELNQTLLDD 326
            |||.:|....|..||:.|...|:|:.|..:.|...|.| |.|:|.|...|:|            |
Human   108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSV------------D 160

  Fly   327 RPINVERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRLDKKKGKEN----GSLKK 387
            : |.:::|...|....:||.|......:..||..:.:..:......|.|...|.:|    |:...
Human   161 K-IVIQKYHTVKGHNCEVRKALPKQEMASASSSQRGRRGSGNFGGGRGDGFGGNDNFGRGGNFSG 224

  Fly   388 EGAPTGQKKKSEYRG 402
            .|...|......|.|
Human   225 RGGFGGSCGGGGYGG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 16/82 (20%)
RRM_SF 261..332 CDD:302621 23/71 (32%)
HNRNPA1L2NP_001011724.1 Globular A domain 4..94 21/115 (18%)
RRM1_hnRNPA1 12..92 CDD:410154 18/101 (18%)
Globular B domain 95..185 30/102 (29%)
RRM_SF 105..184 CDD:418427 28/91 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..216 5/34 (15%)
RNA-binding RGG-box 218..240 5/22 (23%)
HnRNPA1 255..292 CDD:402981
Nuclear targeting sequence. /evidence=ECO:0000250 268..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.