DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and AgaP_AGAP001883

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_321180.5 Gene:AgaP_AGAP001883 / 1281239 VectorBaseID:AGAP001883 Length:396 Species:Anopheles gambiae


Alignment Length:312 Identity:73/312 - (23%)
Similarity:123/312 - (39%) Gaps:59/312 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DEVKAAVQESPKKLSAKDLAKIEKKKAKKQAQKLKKQQNKLAPKEIKTEPEAQVKVESKATKKEK 111
            ::|.||||         ||.|.::::.::|.|:.::||.:                         
Mosquito     3 NKVLAAVQ---------DLQKQQQQQQQQQQQQQQQQQQQ------------------------- 33

  Fly   112 VEKEPTTAPNEKPKGKVSKKAKANANNKDEEGVKRIRNPAEEASTVFVGNLPINTKRVQLVKLFQ 176
             :::.....|....|...:..:..|......|.:...|  ...:.:.|..||......::..||.
Mosquito    34 -QQQQQNGANGGGGGGGGEAGQTVAGGAAGGGGQSSDN--NSRTNLIVNYLPQTMTEEEIRSLFS 95

  Fly   177 PYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVLEKPEIAQQAL-ALNGSEFKENHLRVTPAS 240
            ..|.|:|::|  ...|.:....|.|.......:|...:|:.|:||: .|||...:...|:|:.| 
Mosquito    96 SVGEVESVKL--VRDKNVIYPGQPKGQSLGYGFVNYHRPQDAEQAVNVLNGLRLQNKVLKVSFA- 157

  Fly   241 MAEKFGQAKDKQPSDKDAK-RTIFVGSLKYSATEEQLREIFSSCGEIDYIRCL-QDGDKGCKGVA 303
                       :||.:..| ..:::..|..:.|:|:|..||...|||...|.| |||:...|||.
Mosquito   158 -----------RPSSEGIKGANLYISGLPKTITQEELETIFRPYGEIITSRVLIQDGNDKPKGVG 211

  Fly   304 YVCF-QKPDAVGLALELNQT----LLDDRPINVERYQVKKLGAKQVRDAAAA 350
            ::.| |:.:|......||.|    |.|...:.......:...||.|:.|..|
Mosquito   212 FIRFDQRKEAERAIQALNGTTPKGLTDPITVKFSNTPGQNAAAKVVQPALPA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 21/82 (26%)
RRM_SF 261..332 CDD:302621 25/76 (33%)
AgaP_AGAP001883XP_321180.5 ELAV_HUD_SF 71..396 CDD:273741 56/207 (27%)
RRM1_Hu 73..157 CDD:241094 22/85 (26%)
RRM2_Hu 167..245 CDD:241096 25/77 (32%)
RRM3_Hu 314..391 CDD:240823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55893
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.