DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and AgaP_AGAP001930

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_003435970.1 Gene:AgaP_AGAP001930 / 1281194 VectorBaseID:AGAP001930 Length:412 Species:Anopheles gambiae


Alignment Length:240 Identity:53/240 - (22%)
Similarity:89/240 - (37%) Gaps:72/240 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PAE----EASTVFVGNLPINTKRVQLVKLFQPYG-LVQSIRLRT--AGGKQLFKHKQRKVAGSLN 207
            |||    |...:|||.|...|....|.:.|..|| ::..:.::.  .|..:.|            
Mosquito     9 PAELDDHEKGKLFVGGLSWETSHENLQRYFSRYGEVIDCVVMKNNETGRSRGF------------ 61

  Fly   208 AYVVLEKPEIAQQALALNGSEFKENHLRVTPASMAEKFGQAKDKQP----SDKDAKRT-----IF 263
            .:|....||..::||. ||....:              |:..|.:|    |....|||     :|
Mosquito    62 GFVTFADPENVERALE-NGPHTLD--------------GRTIDPKPCNPRSQHKPKRTGGYPKVF 111

  Fly   264 VGSLKYSATEEQLREIFSSCGEIDYIRCLQDGD-KGCKGVAYVCFQKPDAVGLALELNQTLLDDR 327
            :|.|..:.||..||..|...|.:..:..:.|.: |..:|..::.|:...||       :....|.
Mosquito   112 LGGLPPNITETDLRSFFCRYGTVMEVVIMYDQEKKKSRGFGFLSFENESAV-------ERATTDH 169

  Fly   328 PINV--ERYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGA 370
            .:::  ::.:|||   .:.||.                |||::.:
Mosquito   170 FVHISGKQVEVKK---AEPRDG----------------NQNNSNS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 18/84 (21%)
RRM_SF 261..332 CDD:302621 17/78 (22%)
AgaP_AGAP001930XP_003435970.1 RRM_SF 19..100 CDD:302621 22/107 (21%)
RRM2_DAZAP1 106..185 CDD:240773 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.