DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and AgaP_AGAP008433

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_317010.3 Gene:AgaP_AGAP008433 / 1277542 VectorBaseID:AGAP008433 Length:526 Species:Anopheles gambiae


Alignment Length:354 Identity:93/354 - (26%)
Similarity:143/354 - (40%) Gaps:63/354 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KESEKAELKPIKKEPGVVEDGKVTKKSKTKPKKKTVKVPKDEVKAAVQESP-KKLSAKDLAKIEK 70
            ::.|||..|.....||...| |..::||.:.|.:               || ::..:||.:| ||
Mosquito    37 RDGEKASKKHRSGSPGRNRD-KERRRSKDRSKSR---------------SPARRDRSKDRSK-EK 84

  Fly    71 KKAKKQAQKLKKQQNKLAPKEIKTEP-EAQVKVESKATKKEKVEKEPTTAPN---EKPKGKVSKK 131
            .:.|....:          :|:..|. .::.:|:.:...:|:..:..:.:.:   ...:|:.|..
Mosquito    85 DRGKSDHHR----------REVVVEKRRSRDRVDHRRRSRERDYRRRSRSRDGGRGMGRGRRSMS 139

  Fly   132 AKA-NANNKDEEGVKRIRNPAEE-------ASTVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRT 188
            .|. ....:...|..|.|:|.||       |.|||...|........|.:.|...|.|:.:||.|
Mosquito   140 PKPYRGRGRGGSGYYRDRSPLEEMSQEDRDARTVFCMQLSQRIHARDLEEFFSSVGKVRDVRLIT 204

  Fly   189 AGGKQLFKHKQRKVAGSLNAYVVLEKPEIAQQALALNGSE-----FKENHLRVTPASMAEKFGQA 248
            ....:.||.         .||:..:.||....||.|:|.:     ....|.:.....||.:...|
Mosquito   205 CNKTKRFKG---------IAYIEFKDPESVALALGLSGQKLLGIPISVQHTQAEKNRMASQPPVA 260

  Fly   249 KDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPDA 312
            ..|.||   ....::||||.::.||:.|..||...|:||.|:.:.|.|.| .||..::.|...|.
Mosquito   261 PPKNPS---GPMRLYVGSLHFNITEDMLNGIFEPFGKIDNIQLIMDADTGRSKGYGFITFHNADD 322

  Fly   313 VGLALE-LNQTLLDDRPINV----ERYQV 336
            ...||| ||...|..||:.|    ||..|
Mosquito   323 AKKALEQLNGFELAGRPMKVGNVTERLDV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 22/86 (26%)
RRM_SF 261..332 CDD:302621 29/76 (38%)
AgaP_AGAP008433XP_317010.3 PRP38_assoc <40..109 CDD:289628 22/95 (23%)
SF-CC1 53..511 CDD:273721 87/338 (26%)
RRM1_RBM39_like 172..244 CDD:240729 21/80 (26%)
RRM2_RBM23_RBM39 271..343 CDD:240730 28/71 (39%)
RBM39linker 360..436 CDD:292157
RRM3_RBM39_like 418..502 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.