DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and AgaP_AGAP005117

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_313998.3 Gene:AgaP_AGAP005117 / 1274794 VectorBaseID:AGAP005117 Length:221 Species:Anopheles gambiae


Alignment Length:151 Identity:46/151 - (30%)
Similarity:65/151 - (43%) Gaps:21/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 VLEKPEIAQQALALNGSEFKENHL----RVTPASMAEKFGQAKDKQPSDKDAKRTIFVGSLKYSA 271
            |.|..|.|::...|.....|:..|    ..||...||:..:..:         |:|:||::.|.|
Mosquito    49 VKEMEEEAEKLKQLQSEVTKQMTLGSPTGSTPMLTAEEKAEVDN---------RSIYVGNVDYGA 104

  Fly   272 TEEQLREIFSSCGEIDYIRCL-QDGDKGCKGVAYVCFQKPDAVGLALELNQTLLDDRPINVERYQ 335
            |.|:|...|..||.|:.:..| ...|...||.||:.|...:.|..||.:|:||...|.|.|...:
Mosquito   105 TAEELEAHFHGCGAINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVNPKR 169

  Fly   336 VKKLGAKQ-------VRDAAA 349
            ..:.|..|       ||..||
Mosquito   170 TNRPGMCQTNRFPRGVRGRAA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 7/29 (24%)
RRM_SF 261..332 CDD:302621 27/71 (38%)
AgaP_AGAP005117XP_313998.3 RRM 17..>169 CDD:223796 40/128 (31%)
RRM_II_PABPN1 94..169 CDD:240994 28/74 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.