DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and LOC1274558

DIOPT Version :10

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_313699.4 Gene:LOC1274558 / 1274558 VectorBaseID:AGAMI1_004491 Length:390 Species:Anopheles gambiae


Alignment Length:86 Identity:28/86 - (32%)
Similarity:47/86 - (54%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 DKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQ-KPDAVGLAL 317
            || :.|::|||::.|.||||.|:|||...|.:..::.:.|.:.| .||..:..:: |..|:....
Mosquito    12 DK-SMRSVFVGNIPYDATEEALKEIFCEVGLVLSMKLVYDRETGKPKGYGFCEYKDKETALSAMR 75

  Fly   318 ELNQTLLDDRPINVERYQVKK 338
            .||..:...||:.|:....:|
Mosquito    76 NLNGYVFGGRPLRVDNACTEK 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 156..237 CDD:409828
RRM_SF 261..332 CDD:473069 23/72 (32%)
LOC1274558XP_313699.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.