DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and Hnrnpm

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001103381.1 Gene:Hnrnpm / 116655 RGDID:620369 Length:729 Species:Rattus norvegicus


Alignment Length:288 Identity:69/288 - (23%)
Similarity:108/288 - (37%) Gaps:69/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EAQVKVESKATKKEKVEKEP-TTAPNEKPKGKVSKKAKANANNKDEEGVKRIRNPAEEAST---- 156
            ||..:|.:...|.|:....| ..:.|..|..|..::...|...| |:.:||..|..|..:.    
  Rat     6 EAAAEVAATEPKMEEESGAPCVPSGNGAPVPKGEERPTQNEKRK-EKNIKRGGNRFEPYANPTKR 69

  Fly   157 --VFVGNLPINTKRVQLVKLF-QPYGLVQSIR-LRTAGGKQL------FKHKQ--RKVAGSLNAY 209
              .|:.|:|.:.|...|..|. :..|.|..:. |..|.||..      ||.::  :|.|..||.:
  Rat    70 YRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSRGCAVVEFKMEESMKKAAEVLNKH 134

  Fly   210 VVLEKP---------EIAQQAL-------------------------ALNGSEFKENHLRVTPAS 240
            .:..:|         |.|::|:                         .||......   .:..|.
  Rat   135 SLSGRPLKVKEDPDGEHARRAMQKVMATTGGMGMGPGGPGMINIPPSILNNPNIPN---EIIHAL 196

  Fly   241 MAEKFGQAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYV 305
            .|.:.|.             |:||.:|.|....::|:|:||..|.:.....|:|.|...:|:..|
  Rat   197 QAGRLGS-------------TVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTV 248

  Fly   306 CF-QKPDAVGLALELNQTLLDDRPINVE 332
            .| |..:||......|..||.|||::|:
  Rat   249 TFEQSIEAVQAISMFNGQLLFDRPMHVK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 24/131 (18%)
RRM_SF 261..332 CDD:302621 25/71 (35%)
HnrnpmNP_001103381.1 HnRNP_M 40..69 CDD:402915 7/29 (24%)
RRM1_hnRNPM 71..146 CDD:410058 19/74 (26%)
RRM2_hnRNPM 203..278 CDD:410060 26/87 (30%)
antiphage_ZorA_3 <413..552 CDD:411477
RRM3_hnRNPM 653..729 CDD:410062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.