DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and U2AF2

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_009210.1 Gene:U2AF2 / 11338 HGNCID:23156 Length:475 Species:Homo sapiens


Alignment Length:375 Identity:69/375 - (18%)
Similarity:138/375 - (36%) Gaps:90/375 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DEVKAAVQESP----------KKLSAKDLAKIEKKKAKKQAQKLKKQQNKLAPKEIKTEPEAQVK 101
            ||.:..:.|:.          |:..::..::..|::::.:.::.:.|::....:..:::|..:..
Human     5 DEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRRRSKPLTRGA 69

  Fly   102 VES--------KATKKEKVEK------------EPTTAPNEKPKGKVSKKAKANANNKDEEGVKR 146
            .|.        :..||:||.|            .|......:..|::...|.......|...|..
Human    70 KEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTP 134

  Fly   147 IRNP------AEEASTVFVGNLPINTKRVQLVKLFQPY----GLVQSIRLRTAGGKQLFKHKQRK 201
            ...|      ..:|..::|||:|.......::..|...    ||.|      |.|..:       
Human   135 TPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQ------APGNPV------- 186

  Fly   202 VAGSLN-----AYVVLEKPEIAQQALALNGSEFKENHLRVTPASMAEKFGQAKDKQP----SDK- 256
            :|..:|     |::.....:...||:|.:|..|:...|::.         :..|.||    |:. 
Human   187 LAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIR---------RPHDYQPLPGMSENP 242

  Fly   257 -------------DAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCF 307
                         |:...:|:|.|.....::|::|:.:|.|.:.....::|...| .||.|:..:
Human   243 SVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEY 307

  Fly   308 QKPDAVGLALE-LNQTLLDDRPINVERYQVKKLGAKQVRDAAAASAASKT 356
            ...:....|:. ||...|.|:.:.|:|..|   |||.....:..|..::|
Human   308 VDINVTDQAIAGLNGMQLGDKKLLVQRASV---GAKNATLVSPPSTINQT 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 19/90 (21%)
RRM_SF 261..332 CDD:302621 17/72 (24%)
U2AF2NP_009210.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 12/84 (14%)
Required for interaction with PRPF19. /evidence=ECO:0000269|PubMed:21536736 2..93 13/87 (15%)
Necessary and sufficient to stimulate pre-mRNAs 3'-end cleavage in a CFIm complex-dependent manner. /evidence=ECO:0000269|PubMed:17024186 17..47 2/29 (7%)
U2AF_lg 63..474 CDD:273727 63/317 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.