DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and AgaP_AGAP013051

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_003436593.1 Gene:AgaP_AGAP013051 / 11176155 VectorBaseID:AGAP013051 Length:420 Species:Anopheles gambiae


Alignment Length:306 Identity:59/306 - (19%)
Similarity:101/306 - (33%) Gaps:99/306 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 TVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRKVAGSLNAYVVLEKPEIAQQ 220
            ::.|.|:..:|...||.:.|:.:|.:..|.:.|.|                .|||........|.
Mosquito   122 SIMVRNIRDDTTDWQLYEAFRRFGKIYGILIPTHG----------------TAYVGFYYEAETQC 170

  Fly   221 ALALNGSEFKENHLRV------TPASM------------------------AEKFGQAKDK--QP 253
            ||.:|.:.|..|.:||      .|...                        .|:|..|.|:  ..
Mosquito   171 ALEMNNNMFNGNRMRVEMLRRNLPLQQIDIFDITKNEVRLLRDMLLEVDEKLEQFYSAYDEAFNY 235

  Fly   254 SDKDAK--------------------------------------RTIFVGS-----------LKY 269
            |.||.:                                      |.|..||           :..
Mosquito   236 SSKDYRRWKRKRRRVTPLLSDSSSSSESSSSSVSEISNRSATEVRRILCGSNEENRCLGIFGMNP 300

  Fly   270 SATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQ-KPDAVGLALELNQTLLDDRPINVE 332
            ..||:.|.::||..|.:..|:.:.||... .:|.:::.|: ..||.....:||.|:|:.|.:.|:
Mosquito   301 DTTEKTLMKLFSRYGHVKDIKLIYDGKTNVSRGYSFIYFKHASDARRAQRKLNGTMLEGRKVRVD 365

  Fly   333 RYQVKKLGAKQVRDAAAASAASKTSSKTKAKNQNSAGAKKRLDKKK 378
            ..:.|....:..|....:...:.||:......::.|...|:..|::
Mosquito   366 FSRSKPHEPRADRRKRVSPTVASTSADRCCHRRHGATHHKKRKKRR 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 21/86 (24%)
RRM_SF 261..332 CDD:302621 21/83 (25%)
AgaP_AGAP013051XP_003436593.1 RRM <35..163 CDD:223796 13/56 (23%)
RRM 38..>93 CDD:214636
RRM_SF 123..187 CDD:240668 20/79 (25%)
RRM <286..>381 CDD:223796 22/94 (23%)
RRM_SF 292..367 CDD:302621 19/74 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.