DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12288 and otogl2

DIOPT Version :9

Sequence 1:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_031761380.1 Gene:otogl2 / 101733689 XenbaseID:XB-GENE-6035211 Length:3475 Species:Xenopus tropicalis


Alignment Length:446 Identity:84/446 - (18%)
Similarity:143/446 - (32%) Gaps:110/446 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KTPKAKESEKAELKPIKKEPGVVEDGKVTKKSKTKPKKKTVKVPKDEVKAAVQESPKKL-SAKDL 65
            |..|..::.|:..:..:.|.|.::|.......|.   |:.|...:|||.....:.|..: |::..
 Frog    30 KIYKNGDTVKSNCQICECENGKIKDCARDVNCKI---KRAVTPEQDEVPIVYDDDPSVIESSEGK 91

  Fly    66 AKIEKKKAKKQAQKLKKQQNKLAPKEIKTEPEAQVKVESKATKKEKVEKEPTTAPNEKPKG--KV 128
            ..:..|:|.....|......|.:.....|:       |.|...|..|:.:.......:.||  ..
 Frog    92 GNVRAKRAAVGVNKKNSAATKFSLGITGTD-------EDKEFLKTNVKNDKVNTNQNQGKGHDDS 149

  Fly   129 SKKAKANANNKDEEGVKRIRNPAEE----ASTVFVGNL---PINTKRVQLVKLFQPYGLVQSIRL 186
            .|.:|.|:..|.:|..|:....:.|    .|....||:   .:||.:.|                
 Frog   150 RKDSKENSQEKGQENNKKFSKDSSEEKDDGSKEKWGNVKNDKVNTNQNQ---------------- 198

  Fly   187 RTAGGKQLFKHKQRKVAGSLNAYVVLEKPEIAQQALALNGSEFKEN-------HLRVTPASMAEK 244
                ||   .|...:.....|:.   ||.:...:..:.:.||.|:|       ..:......::.
 Frog   199 ----GK---GHDDSRKDSKDNSQ---EKGQQNNKRFSKDSSEEKDNASKEKSTFKKTYSVQTSQN 253

  Fly   245 FGQAKDKQPSD-KDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKGCKGVAYVCFQ 308
            .|:..|...|: |:.|:..........::||:                 .||.|           
 Frog   254 QGKGHDDSSSESKENKKGQNKNGFSKDSSEEK-----------------DDGSK----------- 290

  Fly   309 KPDAVGLALELNQTLLDDRPINVERYQVKKLGAKQV-RDAAAASAASKTSSKTKAKNQNSAGAKK 372
                                   |:...||..:.|. ::.......|.:.||...|.||..|..|
 Frog   291 -----------------------EKSAFKKTYSVQTSQNQGKGHDDSSSESKENKKGQNKNGFSK 332

  Fly   373 RLDKKKGKENGSLKKEGAPTGQKKKSEYRGVKVDGIKKAKKPKKKSNDQQTALAKK 428
              |..:.|::||.:|.|.....|.|....  |.:....:.|..|::.|:|.....|
 Frog   333 --DSSEEKDDGSKEKSGHGKNDKNKPNIN--KGNDHDDSSKESKENTDRQKGQKNK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 16/91 (18%)
RRM_SF 261..332 CDD:302621 5/70 (7%)
otogl2XP_031761380.1 elast_bind_EbpS 121..442 CDD:411220 65/352 (18%)
VWD 520..683 CDD:214566
TIL 894..953 CDD:396409
VWD 983..1134 CDD:413350
C8 1171..1238 CDD:400886
PHA03247 <2898..3171 CDD:223021
GHB_like 3354..3436 CDD:419725
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.