DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tweek and CG42556

DIOPT Version :9

Sequence 1:NP_001286002.1 Gene:tweek / 35026 FlyBaseID:FBgn0261671 Length:5150 Species:Drosophila melanogaster
Sequence 2:NP_001162994.1 Gene:CG42556 / 8674031 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster


Alignment Length:211 Identity:46/211 - (21%)
Similarity:75/211 - (35%) Gaps:58/211 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  3718 FEEDETQMESPDSDEGDQSCRDTFVR-RRGDFDNLPAFV---FDPTIDSKKRSFMMEKEMAEQLK 3778
            |.:|...|| |:.:||..:.:...:. |..|...:|..|   :...|.|..:.:..:..||::..
  Fly    36 FFDDLDDME-PEDEEGVMNHQYPILHSRHSDLFYMPNCVGPAYQGLISSLDQPYTTDCYMADEQT 99

  Fly  3779 IINDLRTLGASHNTVAHEERRLQELQA-------ICYKYFRRDMIQKWKRPSLRRSLKTYGR--- 3833
            ::.:..::   |:|:      |:.|.|       .|              |.|   |.||.|   
  Fly   100 LVKENDSI---HDTI------LESLVAPTEMCVVAC--------------PKL---LLTYMRRLF 138

  Fly  3834 SHSYIGSGSSVSGVGVPQTLDNVSYTGRRLDTIASNDEISSLQSTPASCHSRSASLKHTTGGGVI 3898
            .|.|...|||:          |.|..|.|.....:|..::|.      .|..|.:.:.....|..
  Fly   139 QHPYARFGSSM----------NFSMIGLRFKDKDANKALTSF------VHFASYNSREIMDNGYW 187

  Fly  3899 GGGVNAL-GRVTFTEA 3913
            ...:|.| ||..:..|
  Fly   188 ADFINPLTGRAYYRAA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tweekNP_001286002.1 FSA_C 4415..5113 CDD:287455
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 27/120 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3596
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.