DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and IFA38

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_009717.1 Gene:IFA38 / 852456 SGDID:S000000363 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:275 Identity:86/275 - (31%)
Similarity:143/275 - (52%) Gaps:29/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GDWAAVTGASDGIGKEYAKELARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGS 113
            |.:.|:||||||||||:|:::|::..|:|||:||:.||:|:.||:.| ...|..||:..|..:..
Yeast    62 GKYCAITGASDGIGKEFARQMAKRGFNLVLISRTQSKLEALQKELED-QHHVVVKILAIDIAEDK 125

  Fly   114 QV-YEHIEKETANIPISILVNNVG--IATPKSLLKYNQEETQNIIDTNVVAVSQLSRIFFQRM-- 173
            :. ||.|::..|.:||::||||||  .:.|...|:..::|.:|||..|..|...:::|...::  
Yeast   126 ESNYESIKELCAQLPITVLVNNVGQSHSIPVPFLETEEKELRNIITINNTATLLITQIIAPKIVE 190

  Fly   174 ------KASKLKGAIVNVGSGTELQPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNF 232
                  |.|..:|.|:.:||...|.|.|..|.|:.||::.:..:.:|..|.....|.|:::. ::
Yeast   191 TVKAENKKSGTRGLILTMGSFGGLIPTPLLATYSGSKSFLQGWSNSLAGELSKDAIDVELII-SY 254

  Fly   233 VVTKINSYSRQIMKGGLLIPSASAYAKSAVNQLRDEVDETPGY-----LWHHV--QNAVATAFTW 290
            :||   |...:|.:..|:||:...:.||.:..:.........|     .|.|.  |..:...|. 
Yeast   255 LVT---SSMSKIRRSSLMIPNPQQFVKSTLRSVGRRCGSQERYATMTPYWAHAVYQFVITETFG- 315

  Fly   291 RVRTYVACKLFNKIS 305
                 |..|:.|.|:
Yeast   316 -----VYSKIVNSIN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 82/264 (31%)
adh_short 51..243 CDD:278532 70/202 (35%)
IFA38NP_009717.1 17beta-HSD1_like_SDR_c 62..310 CDD:187614 81/252 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I1199
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.