DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and Hsd17b12

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_114455.2 Gene:Hsd17b12 / 84013 RGDID:708367 Length:312 Species:Rattus norvegicus


Alignment Length:287 Identity:94/287 - (32%)
Similarity:160/287 - (55%) Gaps:21/287 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAFLTFVGVYALSSYLYEQLRTPYKLIKIRYFS----GTRPTLKERFGDWAAVTGASDGIGKEYA 66
            :.||.:||.   |:..|..||..|.|  .|.|.    |.:..:..|.|:||.|||.:|||||.||
  Rat     8 AGFLYWVGA---STIAYLTLRASYSL--FRAFQVWCVGNQAFVGPRLGEWAVVTGGTDGIGKSYA 67

  Fly    67 KELARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGSQVYEHIEKETANIPISIL 131
            :|||::.:.:|||:|:::||:.|:..|.: ...|:|:.:..||:. ..:|:.|:...:.:.|.:|
  Rat    68 EELAKRGMKIVLISRSQDKLKEVSNNIKE-KFNVETRTIAVDFSL-DDIYDKIKTGLSGLEIGVL 130

  Fly   132 VNNVGIA--TPKSLLKYNQEET--QNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQ 192
            |||||::  .|:..|:....:.  :.:|:.||:::.:::|:....| ..:.||.|:|:.|.:.:.
  Rat   131 VNNVGMSYEYPEYFLEIPDLDNTIKKLININVLSICKVTRLVLPGM-VERSKGVILNISSASGML 194

  Fly   193 PLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLIPSASAY 257
            |:|....|:|:||:....:..|:.|.|..||.||.:.|.||.||:    .:|.|..|..|||..:
  Rat   195 PVPLLTVYSATKAFVDFFSQCLHEEYKSKGIFVQSVLPFFVATKL----AKIRKPTLDKPSAETF 255

  Fly   258 AKSAVNQLRDEVDETPGYLWHHVQNAV 284
            .|||:..:..:. .|.||:.|.:..::
  Rat   256 VKSAIKTVGLQT-RTTGYVIHAIMGSI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 80/240 (33%)
adh_short 51..243 CDD:278532 66/195 (34%)
Hsd17b12NP_114455.2 17beta-HSD1_like_SDR_c 50..289 CDD:187614 80/240 (33%)
Di-lysine motif. /evidence=ECO:0000250 308..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.