DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and KCR2

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_173856.1 Gene:KCR2 / 839063 AraportID:AT1G24470 Length:312 Species:Arabidopsis thaliana


Alignment Length:306 Identity:99/306 - (32%)
Similarity:159/306 - (51%) Gaps:40/306 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLTFVGVYALSSYLYEQLRTPYKLIKIRYFSGTR----PTLKERFGDWAAVTGASDGIGKEYAKE 68
            |:.|:|...|...|:..|        :::|: ||    |...:|:|.||.||||::|||:.:|.|
plant    16 FVCFIGFLFLLRVLFIPL--------LKWFT-TRFLLTPKRLKRYGSWAMVTGATEGIGRAFAHE 71

  Fly    69 LARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADF-TKGSQVYEHIEKETANIPISILV 132
            ||:..:|::|::|...||::|:.:.......::.||:..|| ::|.  |..||:....:.:.||:
plant    72 LAKHGLNLILVSRNLSKLESVSDDFQQEFPHIKIKIIPFDFSSEGG--YGAIEEGIKGLEVGILI 134

  Fly   133 NNVGIATPKSLL--KYNQEETQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTEL---- 191
            |||||..|:::.  :.:|.....|:..|:.|.:.::|.....| ..:.:|||||:.||..:    
plant   135 NNVGITYPRAMFFHEVDQLTWTKILRVNLEATTWVTRSLIGPM-LHRRRGAIVNISSGAAVVVPS 198

  Fly   192 QPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLIPSASA 256
            .||  .|.|||:|||..:|:.:|:.|.|.:||.||...|.:|.|::.|....|.|..|.:||...
plant   199 HPL--YAIYAATKAYVDALSRSLHVEYKQFGIDVQCQVPLYVSTRMVSEVAAIDKPSLFVPSPEV 261

  Fly   257 YAKSAVNQLRDEVDETPGYLWHH----------VQNAVATAFTWRV 292
            |||:||.|:  .:.......|.|          ..|.|.   |||:
plant   262 YAKAAVAQI--GIGSRCSPFWAHSLQWFLVGLVPDNLVD---TWRL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 88/261 (34%)
adh_short 51..243 CDD:278532 69/198 (35%)
KCR2NP_173856.1 PLN02780 8..309 CDD:166421 99/306 (32%)
17beta-HSD1_like_SDR_c 52..293 CDD:187614 83/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D895581at2759
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43899
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.