DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and hsd17b12

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001017234.1 Gene:hsd17b12 / 549988 XenbaseID:XB-GENE-945229 Length:320 Species:Xenopus tropicalis


Alignment Length:253 Identity:91/253 - (35%)
Similarity:149/253 - (58%) Gaps:11/253 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GTRPTLKERFGDWAAVTGASDGIGKEYAKELARQNINVVLIARTEEKLQAVAKEIADCGAGVQTK 103
            |:...:..|.|.||.||||:|||||.||:|||::.:|:|||:|:.|||:.|||:|.: ...|:||
 Frog    46 GSGAQVGPRIGKWAVVTGATDGIGKAYAEELAKRGMNIVLISRSPEKLEEVAKQIKE-KFKVETK 109

  Fly   104 IVIADFTKGSQVYEHIEKETANIPISILVNNVGIA--TPKSLLKYNQEET--QNIIDTNVVAVSQ 164
            |:.|||.|.:::|..||....::.|.:||||||::  .|:..|:....|.  ..:|:.|:.:|.|
 Frog   110 IIAADFGKPTEIYGRIESGLRDLEIGVLVNNVGVSYEHPEYFLEIPDLENTLDKMININITSVCQ 174

  Fly   165 LSRIFFQRMKASKLKGAIVNVGSGTELQPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLS 229
            ::|:....| ..:.:|.|:|:.|.:.:.|:|....|:|:||:....:..|..|.:..|:.||.:.
 Frog   175 MTRLVLPGM-LGRGRGVILNISSASGMYPVPLLTVYSATKAFVDFFSRGLQAEYRSKGVTVQSVL 238

  Fly   230 PNFVVTKINSYSRQIMKGGLLIPSASAYAKSAVNQLRDEVDETPGYLWHHVQNAVATA 287
            |.:|.||:    .:|.|.....||...|.:||:|.:..:. :|.|||.|.:...::|:
 Frog   239 PFYVATKL----AKIRKPTWDKPSPETYVQSALNTVGLQT-QTNGYLPHAIMGWISTS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 89/243 (37%)
adh_short 51..243 CDD:278532 74/195 (38%)
hsd17b12NP_001017234.1 17beta-HSD1_like_SDR_c 56..297 CDD:187614 89/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.