DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and CG13833

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster


Alignment Length:310 Identity:74/310 - (23%)
Similarity:132/310 - (42%) Gaps:38/310 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSAFLTFVGVYALSSYLYEQLRTPYKLIKIRYFSGTRPTLKERFGDWAAVTGASDGIGKEYAKEL 69
            |.|.:..:|:.|::..|.........:.|:.:.|..    |...|:.|.||||..|:|:..:.||
  Fly    12 LQAIIALIGLAAITPLLILVALLGRLIAKLCWCSAP----KSIAGEVAVVTGAGHGLGRAISLEL 72

  Fly    70 ARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGSQVYEHIEKETANI-PISILVN 133
            |::..::.::.......:...|:|.|. ..|:.|...|:.|....:.|...|....: |:::|||
  Fly    73 AKKGCHIAVVDINVSGAEDTVKQIQDI-YKVRAKAYKANVTNYDDLVELNSKVVEEMGPVTVLVN 136

  Fly   134 NVGIATPKSLLKYNQEETQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQPLPNGA 198
            |.|:...:::...:..:.|.:|:.|:.:......:|..:||..: ||.||.:.|...:.|||..|
  Fly   137 NAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELR-KGFIVTISSLAGVFPLPYSA 200

  Fly   199 YYAASK----AYTRSLTLALYHEAKPYGIHVQMLSPNFVVTK--INSYSRQIMKGGL--LIPSAS 255
            .|..:|    |:.|:|.:.|..|.:. .|||..:.|:|:.|.  :...:..|..|.:  |.....
  Fly   201 TYTTTKSGALAHMRTLRMELDLENQK-DIHVTTVLPSFLRTNSDVTQLTHTIGFGDVYPLFTGEE 264

  Fly   256 AYAKSAVNQLRDEVDET-PGYLWHHVQNAVATAFTWRVRTYVACKLFNKI 304
            ...:.....:|.|.:.| ||                     :||.|:..|
  Fly   265 VAQRIVAGMVRGEAEITVPG---------------------MACLLYRVI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 62/256 (24%)
adh_short 51..243 CDD:278532 53/198 (27%)
CG13833NP_651111.1 adh_short 53..241 CDD:278532 52/190 (27%)
NADB_Rossmann 54..297 CDD:304358 65/264 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.