DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and hsd17b3

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_005167205.1 Gene:hsd17b3 / 393335 ZFINID:ZDB-GENE-040426-1339 Length:307 Species:Danio rerio


Alignment Length:295 Identity:94/295 - (31%)
Similarity:151/295 - (51%) Gaps:34/295 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AFLTFVG-VYALSSYLYEQLRTPYKLIKIRYFSGTRPTLKERF----GDWAAVTGASDGIGKEYA 66
            |.|.|.| :.:|...|..:|..|               |.|.|    |.||.:||.|||||:.||
Zfish    15 AILVFGGKIASLIMMLITKLFCP---------------LPEAFFTSLGKWAVITGGSDGIGRAYA 64

  Fly    67 KELARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGSQVYEHIEKETANIPISIL 131
            :||::|.::|::|:|.:|||...||:| :...|.:.|::.||||| ..:|.||.:....:.|.:|
Zfish    65 EELSKQGMSVIIISRNQEKLDRAAKKI-ELNTGGKVKVIAADFTK-DDIYGHITENIEGLDIGVL 127

  Fly   132 VNNVGI---ATPKSLLKYN--QEETQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTEL 191
            ||||||   ..|..||:.:  :|...:|::.||.::.::.||....|: .:.:|.|:||.||...
Zfish   128 VNNVGILPSQIPCKLLETSDLEERIYDIVNCNVKSMVKMCRIVLPGMQ-QRRRGVILNVSSGIAK 191

  Fly   192 QPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLIPSASA 256
            .|.|....|||||.:....:..|..|....||.:|.::|..|.|.:..:    .|..::..:|..
Zfish   192 IPCPIYTLYAASKVFVERFSQGLQAEYISKGIIIQTVAPFGVSTAMTGH----QKPDMVTFTAEE 252

  Fly   257 YAKSAVNQLRDEVDETPGYLWHHVQNAVATAF-TW 290
            :.:|::..|:.. |:|.|.:.|.:...:..:. ||
Zfish   253 FVRSSLKYLKTG-DQTYGSITHTLLGRIVQSIPTW 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 83/248 (33%)
adh_short 51..243 CDD:278532 72/196 (37%)
hsd17b3XP_005167205.1 17beta-HSD1_like_SDR_c 47..287 CDD:187614 83/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.