DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and hsd20b2

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001373557.1 Gene:hsd20b2 / 368367 ZFINID:ZDB-GENE-030804-21 Length:329 Species:Danio rerio


Alignment Length:291 Identity:100/291 - (34%)
Similarity:161/291 - (55%) Gaps:20/291 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CALSAFLTFVGVYALSSYLYEQLRTPYKL---IKIRYFSGTRPTLKERFGDWAAVTGASDGIGKE 64
            |..|..|..:|...:   :|..||..::.   .|:...|....|....:|.||.||||:.|||:.
Zfish     8 CWYSIVLCGIGCVTV---VYYMLRWSWQCWHGFKVYVISEIWRTDLRTYGRWAVVTGATSGIGRA 69

  Fly    65 YAKELARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGSQVYEHIEKETANIPIS 129
            ||:|||::.:|:|||:|:||||..|||||.| ....:|.::.||||:|..:|..|.|:...:.|.
Zfish    70 YAEELAKRGLNIVLISRSEEKLHRVAKEIED-KYNQKTHVIQADFTEGHSIYSTITKQLEGLEIG 133

  Fly   130 ILVNNVGIATPKSLLKY------NQEETQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSG 188
            |||||||:.....|..:      :|..|| :::.|.::|:|:.|:....| ..:.||.|:|:.|.
Zfish   134 ILVNNVGMNYIGVLANFLDVPDPDQRITQ-VLNCNTLSVTQMCRVILPGM-VERGKGLIINISSE 196

  Fly   189 TELQPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLIPS 253
            ...||:|..:.|:|:||:....:|.|..|.:..||.||.::| |:|:...:::..:   ..|:.|
Zfish   197 AGYQPVPMVSLYSATKAFVTYFSLGLNAEYRSKGITVQCVAP-FMVSTNMTHNVPV---NPLVKS 257

  Fly   254 ASAYAKSAVNQLRDEVDETPGYLWHHVQNAV 284
            |:::|:.|:|.: .....|.|.|.|.:|:.|
Zfish   258 AASFARDALNTV-GYTTYTSGCLTHALQHIV 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 90/242 (37%)
adh_short 51..243 CDD:278532 77/197 (39%)
hsd20b2NP_001373557.1 17beta-HSD1_like_SDR_c 54..296 CDD:187614 90/242 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.