DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and Hsdl1

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001020067.1 Gene:Hsdl1 / 361418 RGDID:1308433 Length:330 Species:Rattus norvegicus


Alignment Length:288 Identity:106/288 - (36%)
Similarity:159/288 - (55%) Gaps:18/288 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CALSAFLTFVGVYALSSYLYEQLRTPYKLIKIRYFS--GTRPTLKERFGDWAAVTGASDGIGKEY 65
            |.:.| |..||.:..:......:...|.|:::.:..  |:||.|.:::|.||.::||:|||||.|
  Rat    20 CYVEA-LALVGAWYTARKSIPVICDFYSLVRLHFIPRLGSRPDLIKQYGRWAVISGATDGIGKAY 83

  Fly    66 AKELARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGSQVYEHIEKETANIPISI 130
            |:|||...:|::||::.|||||||||.|||. ..|:|.:::|||::|.::|..|.:...:..|.|
  Rat    84 AEELASHGLNIILISQEEEKLQAVAKHIADT-YRVETLVLVADFSRGREIYAPIREALRDRDIGI 147

  Fly   131 LVNNVGIATPKSLLKYNQEETQ-------NIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSG 188
            |||:||...|     |.|..:|       :|::.|:.|.|.:..|....|...| |||||.|.||
  Rat   148 LVNDVGAFYP-----YPQYFSQVPEDTIWDIVNVNIAAASLMVHIVLPGMVERK-KGAIVTVSSG 206

  Fly   189 TELQPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLIPS 253
            :..:|.|..|.::|||||....:.||.:|....||.||.|.|.:|.:.:.:....:.:...|.||
  Rat   207 SCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVTSSVTAPGSFLRRCPWLAPS 271

  Fly   254 ASAYAKSAVNQLRDEVDETPGYLWHHVQ 281
            ...||:.||:.|... ..|.||..|.:|
  Rat   272 PRVYAQHAVSTLGIS-KRTTGYWSHSIQ 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 95/240 (40%)
adh_short 51..243 CDD:278532 81/198 (41%)
Hsdl1NP_001020067.1 Required for mitochondria translocation. /evidence=ECO:0000250 2..82 20/62 (32%)
17beta-HSD1_like_SDR_c 67..309 CDD:187614 95/240 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335273
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 1 1.000 - - otm45003
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3003
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.720

Return to query results.
Submit another query.