DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and CG2070

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster


Alignment Length:288 Identity:72/288 - (25%)
Similarity:110/288 - (38%) Gaps:50/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFCALS--AFLTFVGVYALSSYLYEQLRTPYKLIKIRYFSGTRPTLKERFGDWAAVTGASDGIGK 63
            :||.|:  :.|:.:|:|.|..|:.               .|...|.....|..|.|||.:.||||
  Fly     8 LFCPLAYGSALSAIGIYLLRQYMQ---------------GGQFTTKTNETGRVAIVTGCNQGIGK 57

  Fly    64 EYAKELARQNINVVLIARTEEKLQAVAKEI--ADCGAGVQTKIV-------IADFTKGSQVYEHI 119
            |...||||:...|.:..|..:|.:...:||  |.....:..:.:       |.:|..|.      
  Fly    58 ETVLELARRGATVYMACRDMKKCENARREIIKATNNQNIFARQLDLCSMKSIRNFAAGF------ 116

  Fly   120 EKETANIPISILVNNVGIATPKSLLKYNQEETQNIIDTNVVAVSQLSRIFFQRMKASK-----LK 179
             |...| .:.||:||.||.....:|..:..|.|  |..|.:....|:.:....:|:|.     :.
  Fly   117 -KREQN-KLHILINNAGIMDCPKMLTEDGFEMQ--IGVNHMGHFLLTLLLLDVLKSSAPSRVVVL 177

  Fly   180 GAIVNVGSGTELQPLPNGAYYAASKAYTRS------LTLALYHEAKPYGIHVQMLSPNFVVTKI- 237
            .:|.:.....:...|.:...|....||.:|      .|..|.......|:.|..|.|..|.|:: 
  Fly   178 SSIAHRFGRIKRDDLNSEKSYDRKMAYCQSKLANVLFTRELAKRLSGTGVTVNALHPGVVNTELF 242

  Fly   238 -NSYSRQIMKGGLLI-PSASAYAKSAVN 263
             |:.......|.||| |....:.|:|.|
  Fly   243 RNTPFLGSWFGKLLIAPIIWIFIKTARN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 62/238 (26%)
adh_short 51..243 CDD:278532 53/213 (25%)
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 62/240 (26%)
NADB_Rossmann 43..317 CDD:304358 62/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.