DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and firl

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001033900.2 Gene:firl / 34627 FlyBaseID:FBgn0032405 Length:318 Species:Drosophila melanogaster


Alignment Length:255 Identity:67/255 - (26%)
Similarity:108/255 - (42%) Gaps:38/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KERFGDWAAVTGASDGIGKEYAKELARQNINVVLI-ARTEEKLQAVAK-EIADCGAGVQTKIVIA 107
            |:..|:...:||...|||:|.|...|.....||.: ...:..||.|.| :..:.|   :......
  Fly    51 KDVSGEIVLITGTGHGIGRELALHYASLGSTVVCVDIDGKNNLQTVEKAKRLNLG---EVYSYSC 112

  Fly   108 DFTKGSQVYEHIEKETANIP-ISILVNNVGIATPKSLLKYNQEETQNIIDTNVVAVSQLSRIFFQ 171
            |.:|..:|....::..:::. ||:|||||||.....:|:.:.||.|.:.|.||.:.....:.|..
  Fly   113 DVSKRDEVTALADRIKSDVGCISVLVNNVGIMPTHPILQQSAEEIQRVFDVNVFSQFWTIQAFLP 177

  Fly   172 RMKASKLKGAIVNVGSGTELQPLPNGAYYAASKAYTRSLTLALYHEAK--------------PY- 221
            .|: .|.:|.|:.:.|...|..:.|...|.|:|...|.|..||:.|.:              || 
  Fly   178 HMQ-EKCRGHIICMSSIAGLVGISNLVPYCATKFAVRGLMEALHAELRQGPFRDLIRTTTIFPYM 241

  Fly   222 ---GI--H--------VQMLSPNFVVTKI-NSYSRQIMKGGLLIPSASAYAKSAVNQLRD 267
               |:  |        :.:|.|..|..:| .::...:|:  :.|||...|..:....|.|
  Fly   242 TNTGLCKHPKVKFPSILGLLDPKQVAKRIVEAHRTDLME--VTIPSCLLYINNWTRLLPD 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 66/251 (26%)
adh_short 51..243 CDD:278532 58/223 (26%)
firlNP_001033900.2 adh_short 56..246 CDD:278532 52/193 (27%)
17beta-HSDXI-like_SDR_c 57..299 CDD:187598 64/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.