DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and Wwox

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster


Alignment Length:285 Identity:63/285 - (22%)
Similarity:106/285 - (37%) Gaps:61/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KERFGDWAAVTGASDGIGKEYAKELARQNINVVLIARTEEKLQAVAKEIAD--CGAGVQTKIVIA 107
            |:..|..|.:|||:.|||.|.|:.||.....::...|.....:|..:.||.  ..|..:.:....
  Fly   117 KDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAAL 181

  Fly   108 DFTKGSQVYEHIEKETANIP-ISILVNNVGIATPKSLLKYNQEETQNIIDTNVVAVSQLSRIFFQ 171
            |.:....|...:|:...::. |..|:.|.|:..    |.|.:  |.:.::| ...||.||. |:.
  Fly   182 DLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFA----LPYTR--TVDGLET-TFQVSHLSH-FYL 238

  Fly   172 RMKASKL---KGAIVNVGSGTEL---QPLPNGAYYAASKAYTRSLTLALYHEA------------ 218
            .::...|   |..|:.:.|.:..   .|:.|.|.:..|....:..::..|:.|            
  Fly   239 TLQLETLFDYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELA 303

  Fly   219 ---KPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLIPSASAYAKSAVNQLRDEVDETPGYLWHHV 280
               |..||.|..|.|..:|:  :..||......||......:.||                   :
  Fly   304 QRWKQRGISVFSLHPGNMVS--SDLSRNYWFYRLLFAIVRPFTKS-------------------L 347

  Fly   281 QNAVATAFTWRVRTYVACKLFNKIS 305
            |.|.||:        :.|...|:::
  Fly   348 QQAAATS--------IYCATANELT 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 60/270 (22%)
adh_short 51..243 CDD:278532 50/215 (23%)
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 63/285 (22%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 62/281 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.