DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and HSD17B3

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_000188.1 Gene:HSD17B3 / 3293 HGNCID:5212 Length:310 Species:Homo sapiens


Alignment Length:279 Identity:97/279 - (34%)
Similarity:156/279 - (55%) Gaps:13/279 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSAFLTFVGVYALSSYLYEQLRTPYKLIKIRYFSGTRPTLKERFGDWAAVTGASDGIGKEYAKEL 69
            |..|....|:....:.|.:.:|.. :.:.:.|:.....:.....|.||.:|||.|||||.|:.||
Human     5 LEQFFILTGLLVCLACLAKCVRFS-RCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFEL 68

  Fly    70 ARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGSQVYEHIEKETANIPISILVNN 134
            |::.:|||||:||.|||:|:|.|| :...|...||:.||||| ..:||||:::.|.:.|.|||||
Human    69 AKRGLNVVLISRTLEKLEAIATEI-ERTTGRSVKIIQADFTK-DDIYEHIKEKLAGLEIGILVNN 131

  Fly   135 VGI---ATPKSLLKYNQEETQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQPLPN 196
            ||:   ..|...|. ..:|.|::|..|:.:|.:::::..:.|: |:.||.|:|:.||..|.|.|.
Human   132 VGMLPNLLPSHFLN-APDEIQSLIHCNITSVVKMTQLILKHME-SRQKGLILNISSGIALFPWPL 194

  Fly   197 GAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLIPSASAYAKSA 261
            .:.|:||||:..:.:.||..|.|...:.:|:|:|..|.|.:..|    :...::..:|..:.|.:
Human   195 YSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKY----LNTNVITKTADEFVKES 255

  Fly   262 VNQLRDEVDETPGYLWHHV 280
            :|.:... .||.|.|.|.:
Human   256 LNYVTIG-GETCGCLAHEI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 91/235 (39%)
adh_short 51..243 CDD:278532 82/194 (42%)
HSD17B3NP_000188.1 17beta-HSD1_like_SDR_c 48..284 CDD:187614 91/235 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2265
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.