DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and scu

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster


Alignment Length:198 Identity:55/198 - (27%)
Similarity:85/198 - (42%) Gaps:25/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VTGASDGIGKEYAKELARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVI--ADFTKGSQVY 116
            |||.:.|:|:..|:.||:|..:|:|......|...||||:.|       |:|.  .|.|....|.
  Fly     9 VTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGD-------KVVFVPVDVTSEKDVS 66

  Fly   117 EHIEKETANIP---ISILVNNVGIATPKSLLKYNQ------EETQNIIDTNVVAVSQLSRIFFQR 172
            ..:  :||...   :.:.||..|.||......:|:      |:.|.:|:.|.|....:.|:....
  Fly    67 AAL--QTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGL 129

  Fly   173 MKASK-----LKGAIVNVGSGTELQPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNF 232
            |.|::     .:|.|||..|..........|.|:||||....:||.:..:....||.:..::|..
  Fly   130 MGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGL 194

  Fly   233 VVT 235
            ..|
  Fly   195 FNT 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 55/198 (28%)
adh_short 51..243 CDD:278532 55/198 (28%)
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 55/198 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.