DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and hsd17b12a

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_957175.1 Gene:hsd17b12a / 327417 ZFINID:ZDB-GENE-030131-5628 Length:319 Species:Danio rerio


Alignment Length:285 Identity:101/285 - (35%)
Similarity:158/285 - (55%) Gaps:19/285 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTFVGVY---ALSSYLYEQLRTPYKLIKIRYFSGTRPTLKERFGDWAAVTGASDGIGKEYAKELA 70
            |.:||..   :|:.|:..:..|.:::    :..|....|..:.|.||.||||:|||||.||:|||
Zfish    17 LFWVGALITASLALYVVYKTITGFRI----WVLGNGDLLSPKLGKWAVVTGATDGIGKSYAEELA 77

  Fly    71 RQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGSQVYEHIEKETANIPISILVNNV 135
            |:..:::||:|::|||..|||.: :....|:||.:..||:: ..||..|||..|.:.|.||||||
Zfish    78 RRGFSMMLISRSQEKLDDVAKSL-ESTYKVETKTIAVDFSQ-IDVYPKIEKGLAGLEIGILVNNV 140

  Fly   136 GI--ATPKSLLKYNQEET--QNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQPLPN 196
            ||  :.|:..|.....|.  ..:|:.|:.:|.|::|:...||:| :.||.|:|:.|.:.:.|:|.
Zfish   141 GISYSYPEFFLHIPDLENFITTMINVNITSVCQMTRLVLPRMEA-RAKGVILNISSASGMFPVPL 204

  Fly   197 GAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLIPSASAYAKSA 261
            ...|:::||:....:..|..|.|..||.:|.:.|.||.||:.    :|.|..|..|:...|..:.
Zfish   205 LTIYSSTKAFVDFFSRGLQTEYKCKGIIIQSVLPFFVATKMT----KIRKPTLDKPTPERYVAAE 265

  Fly   262 VNQLRDEVDETPGYLWHHVQNAVAT 286
            :|.:..: |:|.||..|.|...|.|
Zfish   266 LNTVGLQ-DQTNGYFPHAVMGWVTT 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 93/242 (38%)
adh_short 51..243 CDD:278532 78/195 (40%)
hsd17b12aNP_957175.1 PLN02780 18..310 CDD:166421 100/284 (35%)
17beta-HSD1_like_SDR_c 56..288 CDD:187614 91/239 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.