DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and Mfe2

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster


Alignment Length:318 Identity:74/318 - (23%)
Similarity:123/318 - (38%) Gaps:92/318 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KIRYFSGTRPTLKERFGDWAAVTGASDGIGKEYAKELARQNINVVL---------IARTEEKLQA 88
            |:||           .|..|.||||..|:|:|||...|.:...||:         ...::.....
  Fly     7 KLRY-----------DGRVAVVTGAGAGLGREYALLFAERGAKVVVNDLGGTHSGDGASQRAADI 60

  Fly    89 VAKEIADCGAGVQTKIVIADFTK---GSQVYEHIEKETANIPISILVNNVGIATPKSLLKYNQEE 150
            |..||...|..     .:||:..   |::|.|...|....  :.|||||.||...:||:|.::::
  Fly    61 VVDEIRKAGGE-----AVADYNSVIDGAKVIETAIKAFGR--VDILVNNAGILRDRSLVKTSEQD 118

  Fly   151 TQNIIDTN----------------------VVAVSQLSRIF--FQRMKASKLKGAIVNVGSGTEL 191
            ...:.|.:                      ::..|..|.|:  |.::..:..|..::.:.:...:
  Fly   119 WNLVNDVHLKGSFKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAI 183

  Fly   192 QPLPNGAY------YAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLL 250
            :...|...      .|||:.....|...|::|.||     ::::|  ||..:...|.:  ..|..
  Fly   184 EGARNNVLCNVIVPTAASRMTEGILPDILFNELKP-----KLIAP--VVAYLCHESCE--DNGSY 239

  Fly   251 IPSASAYA--------KSAVNQLRDEVDE--TPGY---LWHHVQN--------AVATA 287
            |.||:.:|        |.||  ||..:|:  |..|   :|.:|.:        |:|.|
  Fly   240 IESAAGWATKLHMVRGKGAV--LRPSLDDPVTIEYVKDVWSNVTDMSKAKHLGAIAEA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 71/302 (24%)
adh_short 51..243 CDD:278532 52/233 (22%)
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 60/275 (22%)
PRK07791 11..248 CDD:236099 57/252 (23%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.