DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and hsd17b12b

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_955907.1 Gene:hsd17b12b / 322626 ZFINID:ZDB-GENE-030131-1346 Length:311 Species:Danio rerio


Alignment Length:260 Identity:95/260 - (36%)
Similarity:148/260 - (56%) Gaps:21/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GDWAAVTGASDGIGKEYAKELARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGS 113
            |.||.||||:|||||.||:||||:...:|||:||:|||..|:|.| :....|:||.:.|||  ||
Zfish    48 GKWAVVTGATDGIGKAYAEELARRGFAIVLISRTQEKLDEVSKAI-ESKYKVETKTISADF--GS 109

  Fly   114 -QVYEHIEKETANIPISILVNNVGI--ATPKSLLKYNQEET--QNIIDTNVVAVSQLSRIFFQRM 173
             .:|..||...|.:.|.:||||||:  :.|:..|.....::  .|:|:.|:::|.|::|:...||
Zfish   110 VDIYPKIESGLAGLEIGVLVNNVGVSYSYPEFFLNIPDVDSFINNMININIMSVCQMTRLVLPRM 174

  Fly   174 KASKLKGAIVNVGSGTELQPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKIN 238
             ..:.||.|:||.|.:.:.|:|....|:::||:....:..|..|.|..||.:|.:.|.:|.||::
Zfish   175 -VDRSKGVILNVASASGMYPVPLLTLYSSTKAFVDFFSRGLDAEYKSKGIIIQSVLPFYVTTKLS 238

  Fly   239 SYSRQIMKGGLLIPSASAYAKSAVNQLRDEVDETPGYLWHHVQNAVATAFTWRVRTYVACKLFNK 303
                :|.|..|.||:...|.|:.::.:..:. ::.|||.|.:..       |...:.:..||.||
Zfish   239 ----KIRKPTLDIPTPERYVKAQLSTIGLQT-QSNGYLPHAIMG-------WVTASLLPAKLLNK 291

  Fly   304  303
            Zfish   292  291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 91/251 (36%)
adh_short 51..243 CDD:278532 78/196 (40%)
hsd17b12bNP_955907.1 PLN02780 8..307 CDD:166421 95/260 (37%)
17beta-HSD1_like_SDR_c 48..285 CDD:187614 91/252 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.