DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and CG31809

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster


Alignment Length:298 Identity:137/298 - (45%)
Similarity:195/298 - (65%) Gaps:8/298 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGVYALSSYLYEQLRTPYKLIKI---RYFSGTRP-TLKERFGDWAAVTGASDGIGKEYAKELARQ 72
            ||..:::::|||.|::.:.:||.   .:|....| ||.|:||:||.||||:||||||||:|||||
  Fly     7 VGSLSIAAFLYENLKSLFSIIKSVVEPFFRPNLPKTLAEKFGNWAVVTGATDGIGKEYARELARQ 71

  Fly    73 NINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGSQVYEHIEKETANIPISILVNNVG- 136
            .:|:||::|.||||.||..||.. ...|:.|.::|||.||.:||.|||||...|.:.||||||| 
  Fly    72 GLNLVLVSRKEEKLIAVTNEIGS-QYNVKIKWIVADFAKGREVYAHIEKELNGIEVGILVNNVGT 135

  Fly   137 IATPKSLLKYNQEETQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQPLPNGAYYA 201
            |..|:||.|.:::...:::..||.:|:.|:|....:| .|:.||||||:||.:||||.||...||
  Fly   136 IHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQM-ISRRKGAIVNLGSSSELQPHPNLTAYA 199

  Fly   202 ASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLIPSASAYAKSAVNQLR 266
            |:|.:....|..|.:|...:.||||::.|.||.|.:||||.::.:||||.|:|.:||:|||..| 
  Fly   200 ATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSAVFTL- 263

  Fly   267 DEVDETPGYLWHHVQNAVATAFTWRVRTYVACKLFNKI 304
            .:..||.|:..|.:|.|:...|...:|||...:||.::
  Fly   264 GKTSETNGFWVHGLQYALMKLFPMEIRTYFVYQLFKRM 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 120/247 (49%)
adh_short 51..243 CDD:278532 98/192 (51%)
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 117/240 (49%)
DltE 50..302 CDD:223377 122/255 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439087
Domainoid 1 1.000 148 1.000 Domainoid score I2740
eggNOG 1 0.900 - - E1_COG0300
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D125652at50557
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 1 1.000 - - otm42934
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43899
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3003
98.850

Return to query results.
Submit another query.