DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and Ldsdh1

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster


Alignment Length:248 Identity:62/248 - (25%)
Similarity:103/248 - (41%) Gaps:34/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PTLKERFGDWAAVTGASDGIGKEYAKELARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVI 106
            |.|.:..|....:||...|:|||.|.:.|:....::.....|:......|||.:.|.  :....:
  Fly    51 PPLDDVNGKVVLITGTGHGMGKEMALQYAKLGATILCWDVNEQTNNQTVKEIKNNGG--KAFGYV 113

  Fly   107 ADFTKGSQVYE---HIEKETANIPISILVNNVGIATPKSLLKYNQEETQNIIDTNVVAVSQLSRI 168
            .:.||..::.|   .:.||...  |.::|||.||.....||::.:.|.:.:.:.||::...:.:.
  Fly   114 CNVTKREELIELAQKVRKEHGF--IHVVVNNAGIMPCHPLLEHTENEIRLMYEINVLSHFWIIQA 176

  Fly   169 FFQRMKASKLKGAIVNVGSGTELQPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSP--N 231
            |...| ..:.:|:||.:.|...|..|.|...|..:|...|....||..|       ::..:|  |
  Fly   177 FLPDM-IERNEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYMAALVEE-------LRQKNPQNN 233

  Fly   232 FVVTKINSYSRQIMKGGL-------------LIPSASAYAKSAVNQLRDEVDE 271
            ..:|.|..|   ::..||             ||| |...|.|.:...|..::|
  Fly   234 VKLTTIYPY---MIDTGLCKNPRYRFPNLFKLIP-ADVAAGSIIEAQRQGLEE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 60/241 (25%)
adh_short 51..243 CDD:278532 49/196 (25%)
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 49/203 (24%)
NADB_Rossmann 60..287 CDD:304358 59/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.