DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and CG3842

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster


Alignment Length:327 Identity:83/327 - (25%)
Similarity:119/327 - (36%) Gaps:60/327 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ALSAFLTFVGVYALSSYLYEQLRTPYKLIKIRYFSGTRPTLKERFGDWAAVTGASDGIGKEYAKE 68
            |:..||..:|:......|.:.::.|      .|....|..     |....|||.:.|||||...|
  Fly    40 AVLIFLIVLGILLFMWLLRKCIQGP------AYRKANRID-----GKVVIVTGCNTGIGKETVLE 93

  Fly    69 LARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGSQVYEHIEK-ETANIPISILV 132
            ||::...|.:..|...:.:|...:|.|.....|......|......|...:|: :.....:.||:
  Fly    94 LAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRNFVERFKAEESRLDILI 158

  Fly   133 NNVGI-ATPKSLLKYNQEETQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQPLPN 196
            ||.|: |.|::|.....|:...:   |.:....|:.:...|:|.|. ...||.|.|...|....|
  Fly   159 NNAGVMACPRTLTADGFEQQFGV---NHLGHFLLTNLLLDRLKHSS-PSRIVVVSSAAHLFGRIN 219

  Fly   197 --------------GAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSY------- 240
                          || |:.||......||.|....|..|:.|....|..|.|:||.:       
  Fly   220 REDLMSEKNYSKFFGA-YSQSKLANILFTLKLSTILKDTGVTVNCCHPGVVRTEINRHFSGPGWM 283

  Fly   241 SRQIMKGGLLI---PSASAYAKSAVNQLRDEVD-----ETPGY--------LWHHVQNAVATAFT 289
            ...:.||.|..   |.|.|.     .|||..:|     .|.||        |:..|:|.....:.
  Fly   284 KTALQKGSLYFFKTPKAGAQ-----TQLRLALDPQLEGSTGGYYSDCMRWPLFPWVRNMQTADWL 343

  Fly   290 WR 291
            ||
  Fly   344 WR 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 75/282 (27%)
adh_short 51..243 CDD:278532 56/214 (26%)
CG3842NP_001259270.1 FabG 71..319 CDD:223959 68/262 (26%)
NADB_Rossmann 74..347 CDD:304358 75/282 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447703
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.