DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and SPAC4G9.15

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_593697.1 Gene:SPAC4G9.15 / 2543099 PomBaseID:SPAC4G9.15 Length:341 Species:Schizosaccharomyces pombe


Alignment Length:273 Identity:84/273 - (30%)
Similarity:145/273 - (53%) Gaps:23/273 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FCALSAFLTFVGVYALSSYLYEQLRTPYKLIKIRYFSGTRPTLKERFGDWAAVTGASDGIGKEYA 66
            |..:....|.:...:.:|::|:....  |.:|:..:...:       |.||.||||:||||||||
pombe    19 FSVIGIVFTILKFTSFASFVYKTFFA--KGVKLSVYGAKK-------GYWAVVTGATDGIGKEYA 74

  Fly    67 KELARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTK-GSQVYEHIEKETANIPISI 130
            .:||....|||||:||:|||.|:|||: :..|.|:|:.:..|:|| .::.:|.:.::....||::
pombe    75 TQLAMSGFNVVLISRTQEKLDALAKEL-ETVAKVKTRTIAIDYTKTTAETFEKLHQDLVGTPITV 138

  Fly   131 LVNNVGIA--TPKSLLKYNQEETQNIIDTNVVAV-----SQLSRIFFQRMKASK-LKGAIVNVGS 187
            |:||||.:  .|.|..:...:|..:|:..|....     :.||.:..:|.|..| .:..|:.:||
pombe   139 LINNVGQSHYMPTSFAETTVKEMDDIMHINCFGTLHTTKAVLSIMLRERQKNEKGPRCLILTMGS 203

  Fly   188 GTELQPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLIP 252
            ...|.|.|..:.||.|||:..:.:.:|..|.|..||.|...:...||:.::    ::.:..|.||
pombe   204 FAGLLPSPYLSTYAGSKAFLSNWSASLGEEVKKQGIDVWCFNSYLVVSAMS----KVRRPTLTIP 264

  Fly   253 SASAYAKSAVNQL 265
            :...:.::|::.:
pombe   265 TPKKFVRAALSSI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 78/226 (35%)
adh_short 51..243 CDD:278532 73/200 (37%)
SPAC4G9.15NP_593697.1 DltE 52..338 CDD:223377 78/238 (33%)
17beta-HSD1_like_SDR_c 57..305 CDD:187614 78/226 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 128 1.000 Domainoid score I1355
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.