DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and stdh-2

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_507092.1 Gene:stdh-2 / 184337 WormBaseID:WBGene00008678 Length:315 Species:Caenorhabditis elegans


Alignment Length:284 Identity:92/284 - (32%)
Similarity:140/284 - (49%) Gaps:21/284 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLTFVGVYALSSYLYEQLRTPYKLIKIRYFSGTRPTLKERFG-DWAAVTGASDGIGKEYAKELAR 71
            |.|.||...:....|..:|....:: :.|.......||::.| .||.||||:|||||.|:.||||
 Worm     6 FATGVGAAVVLYIFYHFIRIILNIL-VPYAFCQPIDLKKKAGASWAVVTGATDGIGKSYSFELAR 69

  Fly    72 QNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGSQV-YEHIEKETANIPISILVNNV 135
            :..||.:::||:.||:...|:|.:....::.:....|||..|.. ||.:..:...:.:.||:|||
 Worm    70 RGFNVYIVSRTQSKLEQTKKDILEKQPDIEVRFATYDFTNPSVTDYEKLLSKLNEVSVGILINNV 134

  Fly   136 GI--ATPKSLLKYNQ--EETQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQPLPN 196
            |:  ..|:.|.|.|.  :...|:|..|.:..:.||.....:| .|:..|.|||:||...:..|..
 Worm   135 GMFFDYPEMLHKINGGIDSIANVIIINTLPATLLSAGILPQM-VSRKAGIIVNIGSFAGVVKLAE 198

  Fly   197 GAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKG----GLLIPSASAY 257
            .:.|:|:|.|...||..|..|...:||..|.::|..|.||        |.|    ....|.:..:
 Worm   199 WSIYSATKKYVEWLTGCLRKEYSHHGIIFQAITPAMVATK--------MAGNPNTSFFCPDSDTF 255

  Fly   258 AKSAVNQLRDEVDETPGYLWHHVQ 281
            |:||:|.: ....||.||:.|.:|
 Worm   256 ARSALNTI-GHASETTGYIAHQIQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 83/243 (34%)
adh_short 51..243 CDD:278532 69/196 (35%)
stdh-2NP_507092.1 PLN02780 19..312 CDD:166421 88/271 (32%)
17beta-HSD1_like_SDR_c 47..289 CDD:187614 82/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I2740
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.