DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and stdh-3

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_506448.2 Gene:stdh-3 / 182292 WormBaseID:WBGene00007364 Length:315 Species:Caenorhabditis elegans


Alignment Length:293 Identity:89/293 - (30%)
Similarity:150/293 - (51%) Gaps:25/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLTFVGVYALSSYLYEQLRTPYKLIKIRYFSGTRP-TLKERFG-DWAAVTGASDGIGKEYAKELA 70
            |...||...:...||..::..:.::.:..|  .:| .||::.| .||.:||.:|||||.::.|||
 Worm     6 FAIGVGAIVVLYILYHFIKMIWSILGLYVF--YQPIDLKKKAGASWAVITGGTDGIGKSFSFELA 68

  Fly    71 RQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGS-QVYEHIEKETANIPISILVNN 134
            ::..|:.:::||:.||:...|||.:..:.|:.:....|||..| ..|:.:..:...:.|.:|:||
 Worm    69 KRGFNIYIVSRTQSKLEQTKKEIMEKYSNVEVRFATFDFTNPSISDYKKLLSQLNEVSIGMLINN 133

  Fly   135 VGIATPKSLLKY--NQEETQNIIDT-------NVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTE 190
            ||:     |.:|  |..:|...||.       |.:.|:.||.....:| .|:..|.|||:||...
 Worm   134 VGM-----LFEYPENLHKTVGGIDVVANVTILNTLPVTLLSAGILPQM-VSRKTGIIVNIGSVAG 192

  Fly   191 LQPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLIPSAS 255
            ...:...:.|:|||.|...||..|..|.:..||.:|.::|..|.||::.::    :..|..|.::
 Worm   193 AAKMAEWSVYSASKKYVEWLTGCLRKEYEHQGIIIQAITPALVATKLSGHT----ETSLFCPDSA 253

  Fly   256 AYAKSAVNQLRDEVDETPGYLWHHVQNAVATAF 288
            .:||||:|.: ....:|.||:.|.:|..:...|
 Worm   254 TFAKSALNTV-GHTSQTTGYINHQIQCEMLALF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 80/251 (32%)
adh_short 51..243 CDD:278532 66/201 (33%)
stdh-3NP_506448.2 PLN02780 13..312 CDD:166421 86/286 (30%)
17beta-HSD1_like_SDR_c 47..287 CDD:187614 79/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I2740
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.