DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and stdh-1

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_506449.1 Gene:stdh-1 / 182291 WormBaseID:WBGene00007363 Length:314 Species:Caenorhabditis elegans


Alignment Length:285 Identity:92/285 - (32%)
Similarity:139/285 - (48%) Gaps:23/285 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLTFVGVYALSSYLYEQLRTPYKLIKIRYFSGTRP-TLKERFG-DWAAVTGASDGIGKEYAKELA 70
            |.|.||...:...||..:|....::....|  .:| .||::.| .||.||||:|||||.|:.|||
 Worm     6 FATGVGAVVVLYILYHFIRITLNILGPYVF--CQPIDLKKKAGASWAVVTGATDGIGKSYSFELA 68

  Fly    71 RQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGS-QVYEHIEKETANIPISILVNN 134
            ::..||.:::||:.||:...|||.:....::.:....|||..| ..||.:..:...:.|.||:||
 Worm    69 KRGFNVYIVSRTQSKLEHTKKEILEVHPDIEVRFATFDFTNPSVSDYEKLLSKLNEVSIGILINN 133

  Fly   135 VGI--ATPKSLLKYNQ--EETQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQPLP 195
            ||:  ..|:.|.|.|.  :...|:...|.:..:.||.....:|...| .|.|||:||...|..:.
 Worm   134 VGMFFDYPEMLHKINGGIDSIANVTIINTLPATLLSAGILPQMVPRK-AGIIVNIGSVAGLATMA 197

  Fly   196 NGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKG----GLLIPSASA 256
            ..:.|:|:|.|...:|..|..|....||..|.::|..|.||        |.|    ....|.:..
 Worm   198 EWSVYSATKKYVEWITGCLQKEYGHQGIIFQAITPAMVATK--------MAGNPNTSFFTPDSDT 254

  Fly   257 YAKSAVNQLRDEVDETPGYLWHHVQ 281
            :||||:|.: ....:|.||:.|.::
 Worm   255 FAKSALNTI-GHASQTTGYITHQIE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 81/243 (33%)
adh_short 51..243 CDD:278532 68/196 (35%)
stdh-1NP_506449.1 17beta-HSD1_like_SDR_c 47..289 CDD:187614 80/242 (33%)
adh_short 49..242 CDD:278532 69/201 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I2740
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.