DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and Hsd17b3

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_032317.2 Gene:Hsd17b3 / 15487 MGIID:107177 Length:305 Species:Mus musculus


Alignment Length:279 Identity:97/279 - (34%)
Similarity:150/279 - (53%) Gaps:30/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FVGVYAL------SSYLYEQLRTPYKLIKIRYFSGTRPTLKERFGDWAAVTGASDGIGKEYAKEL 69
            |||:..|      |.:|:           :|:......:.....|.||.:|||.|||||.|:.||
Mouse    11 FVGLVCLVKCMRFSQHLF-----------LRFCKALPSSFLRSMGQWAVITGAGDGIGKAYSFEL 64

  Fly    70 ARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGSQVYEHIEKETANIPISILVNN 134
            ||..:|||||:||.||||.:|:|| :...|...|||.||||: ..:|:||::....:.|.|||||
Mouse    65 ARHGLNVVLISRTLEKLQTIAEEI-ERTTGSCVKIVQADFTR-EDIYDHIKEHLEGLEIGILVNN 127

  Fly   135 VGIAT---PKSLLKYNQEETQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQPLPN 196
            ||:..   |...|. ...|:||:|..|:.:|.:::::..:.|: |:.||.|:|:.||..|:|.|.
Mouse   128 VGMLPSFFPSHFLS-TSGESQNLIHCNITSVVKMTQLVLKHME-SRRKGLILNISSGAALRPWPL 190

  Fly   197 GAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLIPSASAYAKSA 261
            .:.|:||||:..:.:.||..|.:..||.:|:|:|..:.|.:..|....|     ..:|..:.|.:
Mouse   191 YSLYSASKAFVYTFSKALSVEYRDKGIIIQVLTPYSISTPMTKYLNNKM-----TKTADEFVKES 250

  Fly   262 VNQLRDEVDETPGYLWHHV 280
            :..:.... |:.|.|.|.:
Mouse   251 LKYVTIGA-ESCGCLAHEI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 90/235 (38%)
adh_short 51..243 CDD:278532 82/194 (42%)
Hsd17b3NP_032317.2 17beta-HSD1_like_SDR_c 44..280 CDD:187614 90/235 (38%)
adh_short 45..236 CDD:278532 82/194 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2265
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.