DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and Hsd17b3

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_446459.1 Gene:Hsd17b3 / 117182 RGDID:621805 Length:306 Species:Rattus norvegicus


Alignment Length:289 Identity:93/289 - (32%)
Similarity:153/289 - (52%) Gaps:33/289 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSAFLTFVGVYA----------LSSYLYEQLRTPYKLIKIRYFSGTRPTLKERFGDWAAVTGASD 59
            :..||..||:..          .|.||:           :.:......:.....|.||.:|||.|
  Rat     1 MEQFLLSVGLLVCLVCLVKCVRFSRYLF-----------LSFCKALPGSFLRSMGQWAVITGAGD 54

  Fly    60 GIGKEYAKELARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGSQVYEHIEKETA 124
            ||||.|:.||||..:|||||:||.||||.:::|| :...|.:.|:|.||||: ..:|:|||::..
  Rat    55 GIGKAYSFELARHGLNVVLISRTLEKLQVISEEI-ERTTGSRVKVVQADFTR-EDIYDHIEEQLK 117

  Fly   125 NIPISILVNNVGI---ATPKSLLKYNQEETQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVG 186
            .:.|.:||||||:   ..|...|. ...|:|::|..|:.:|.:::::..:.|: |:.:|.|:|:.
  Rat   118 GLEIGVLVNNVGMLPNLLPSHFLS-TSGESQSVIHCNITSVVKMTQLVLKHME-SRRRGLILNIS 180

  Fly   187 SGTELQPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLI 251
            ||..::|.|..:.|:||||:..:.:.||..|.:..||.:|:|:|..|.|.:..|    :....:.
  Rat   181 SGVGVRPWPLYSLYSASKAFVCTFSKALNVEYRDKGIIIQVLTPYSVSTPMTKY----LNTSRVT 241

  Fly   252 PSASAYAKSAVNQLRDEVDETPGYLWHHV 280
            .:|..:.|.::..:.... ||.|.|.|.:
  Rat   242 KTADEFVKESLKYVTIGA-ETCGCLAHEI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 86/235 (37%)
adh_short 51..243 CDD:278532 78/194 (40%)
Hsd17b3NP_446459.1 17beta-HSD1_like_SDR_c 44..281 CDD:187614 86/235 (37%)
adh_short 45..236 CDD:278532 78/198 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.