DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6012 and XB5863530

DIOPT Version :9

Sequence 1:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_002941866.3 Gene:XB5863530 / 100497556 XenbaseID:XB-GENE-5863531 Length:346 Species:Xenopus tropicalis


Alignment Length:247 Identity:89/247 - (36%)
Similarity:141/247 - (57%) Gaps:13/247 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RPTLKERFGDWAAVTGASDGIGKEYAKELARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIV 105
            :|.|:: :|.||.||||:|||||.||:||||:..::|||:|:.||||.||:.| :..:|.:|||:
 Frog    71 KPNLRQ-YGTWAVVTGATDGIGKSYAEELARRGFDIVLISRSPEKLQRVAEGI-EQKSGRKTKII 133

  Fly   106 IADFTKGSQVYEHIEKETANIPISILVNNVGIATPKSLLKY-----NQEETQNIIDTNVVAVSQL 165
            .||:|....:|..||:....:.|.:||||||:|.....:::     .:|...|:|:.|:|:|.|:
 Frog   134 QADYTGDVGIYTPIEEGLKGLDIGVLVNNVGMAYSNEPVRFLDVPNVKERLTNVINCNIVSVLQM 198

  Fly   166 SRIFFQRMKASKLKGAIVNVGSGTELQPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSP 230
            :||....| ..|.||.|:|:.|.....|.|..|.|:::|.:....:..|:.|..|.||.||.:.|
 Frog   199 TRIVLPGM-LKKKKGLIINISSEAGSHPFPMVAVYSSTKVFVDYFSRCLHTEYSPQGITVQSVMP 262

  Fly   231 NFVVTKINSYSRQIMKGGLLIPSASAYAKSAVNQLRDEVDETPGYLWHHVQN 282
            ..|.|.:...    :|..:.:.::.:|...|:|.: .....|.|.|.|.:|:
 Frog   263 LLVSTNMTFG----IKSNIFVKTSDSYVYDALNTV-GSTTRTNGCLSHALQS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 87/239 (36%)
adh_short 51..243 CDD:278532 77/196 (39%)
XB5863530XP_002941866.3 17beta-HSD1_like_SDR_c 78..315 CDD:187614 87/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.