DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl9 and CG32762

DIOPT Version :9

Sequence 1:NP_609815.1 Gene:Nepl9 / 35020 FlyBaseID:FBgn0032613 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001284894.1 Gene:CG32762 / 318198 FlyBaseID:FBgn0052762 Length:200 Species:Drosophila melanogaster


Alignment Length:64 Identity:18/64 - (28%)
Similarity:29/64 - (45%) Gaps:13/64 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 AQQLC-----NRQTEIFA--AQL-NRGYMNLPEFQ----EAFKCGAEKAMNPPSRCMINMCERP 650
            :||:|     |||.::.|  .|| |:...:.|...    :..:||..:..:.|..| |.:..||
  Fly   125 SQQICVRSRDNRQCKVLANSCQLRNQNCHSQPRNNWLRTDRRRCGQLQLGDKPQNC-IRVPVRP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl9NP_609815.1 GluZincin 62..>84 CDD:301352
GluZincin <579..642 CDD:301352 14/54 (26%)
CG32762NP_001284894.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.