DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl9 and frma

DIOPT Version :9

Sequence 1:NP_609815.1 Gene:Nepl9 / 35020 FlyBaseID:FBgn0032613 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_572226.2 Gene:frma / 31464 FlyBaseID:FBgn0029769 Length:611 Species:Drosophila melanogaster


Alignment Length:738 Identity:142/738 - (19%)
Similarity:229/738 - (31%) Gaps:292/738 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YKSNLQQL------VKIK-NDSMDPCDDFYAHACGNFDQTKEENS-DDFLPPYLYNKQDRM---- 98
            :|..|.:|      |::| :...|||.:||..||||:..:...:| :.|:....||.|:::    
  Fly     3 FKLRLLELIVGLLVVQVKSHPQADPCQNFYKVACGNWSASHATDSYESFMDRLDYNYQEKLADLL 67

  Fly    99 --------NFFTAEVGNFETIPGRLISQLYTECRK---------------------REERNVFTP 134
                    ..|..::.||           ||.|||                     .||.:|   
  Fly    68 DNEREDDEPHFLQQLRNF-----------YTACRKPLSQDQVLRILEHLIVMENIQNEELSV--- 118

  Fly   135 TRLTS---------------------------HWE-----------RMLD-------EIPFLARH 154
             .||:                           ||:           .|.|       :|||    
  Fly   119 -GLTAAFRLQVLIDLNDSNTYDIWKQLMSHRKHWDPNTTNREPLTREMFDKLWASLPKIPF---- 178

  Fly   155 KEVLSSWPFLKHQW-------ERRRLYGQLN---------------WIV--LSAQLAAHGLPTLL 195
                   ||.::.|       |:...||..:               |::  .:..:....|..:.
  Fly   179 -------PFKEYYWRELSELEEKIMSYGSEDDGFDSGDLVTRIPPFWMMPWPNGNITYENLSQMA 236

  Fly   196 HIY------FALDTIYVSPMEELPCPSIADFQSSLSDVLEGRHHQVSRIISHEMRVLCREMRGEL 254
            |..      |.|..||:                .|..|.||    ||....|..|..|.|...::
  Fly   237 HWLDIKANEFILTYIYM----------------RLKLVAEG----VSTESWHIDRDQCAEQSRQI 281

  Fly   255 PLVRSLSQNTRTNTSRPGEEQLLLDENTMDYFQQYFAAL--NFSEERLVGARKFPLDVEKITQAW 317
             |....:.....|..|..||.:|         |..||.|  .|.::.|.....|           
  Fly   282 -LSHPAAWLVEKNHPRLKEEPVL---------QDIFAELKQRFGQKLLANRNNF----------- 325

  Fly   318 EVLRHTETRIVYNYVMWQ-AREQLRYPDCYRVSEEFERLLHAEYWQWHVLRRHLSREVALASYQL 381
                   ||...::::.: .|.:||.....|.|.....:...|        ||. |:|.:.:...
  Fly   326 -------TRSTQHFLLGKLKRMRLRLSILPRNSSAQSMVRRIE--------RHY-RDVHMNASDY 374

  Fly   382 HTTRFQKLRRSKLSRRDWYGHLW---------PASVEKKELQVARILQNHAENYLNITELNENYE 437
            .......|..|:..::  |..||         |:.:.|.:|...::                  .
  Fly   375 FGNLHIGLNHSRSHKK--YAQLWAIVFGRQLIPSRISKSDLYPTQV------------------R 419

  Fly   438 GLKLEKNSFY---ANLLILRRAQLRHSFVSPYVDEEDVNQPAYFLRHFLHFVLLSLHRPTYHY-- 497
            |.....::||   .|:||:..:.|...|.:.       .||:......|.|:|  .|..::.:  
  Fly   420 GYGTYASAFYIVKQNMLIVPLSLLEPPFYTH-------GQPSILTYSALGFIL--GHELSHGFDS 475

  Fly   498 ----YATHGL-------ELWRESRLLLDTDGHYTAMDCLERQSFQHYDAKLAPIYRPLGSHEIAE 551
                :::||:       ||.|..|...:       :.||.|:    :..|....:......|:| 
  Fly   476 EGMTFSSHGVGSSAVDRELDRNPRFQQE-------LGCLRRR----FGRKRYEKFADASGLELA- 528

  Fly   552 IFQFYRSFQYSLTDYHFWLQGERFAFAETFVLDYFGLNPHRVLFYAVAQQLCNRQTEIFAA---- 612
             :..|  |..:.||:      :|...||..|      ...:..|:..||..|: ..|:..|    
  Fly   529 -YSAY--FDTAQTDH------KRNRSAEELV------TQKQQFFHNFAQFFCS-DKELLQAHDHG 577

  Fly   613 ----QLNRGYMNLPEFQEAFKCG 631
                ::|....:...|:|||.||
  Fly   578 SDRKRVNDAVAHFEPFREAFSCG 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl9NP_609815.1 GluZincin 62..>84 CDD:301352 10/22 (45%)
GluZincin <579..642 CDD:301352 15/61 (25%)
frmaNP_572226.2 GluZincin 25..601 CDD:301352 137/716 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.