DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and CG34447

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster


Alignment Length:308 Identity:118/308 - (38%)
Similarity:162/308 - (52%) Gaps:25/308 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PCKWAIGRSCPDPDVKYYIY---TRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIHGYNS 124
            |....:...||:.::.:::|   ||.||:         .|:..:|....|.|..|.||:||||..
  Fly    28 PACQVVRGECPNKNISFWLYSNSTRENPI---------LLDPLDLNPWNFQPPRPLKILIHGYTG 83

  Fly   125 DMFLHPLQQMREEYLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVE---TGN 186
            |....|...:|...|...|..:|.:|:..|...||||.||.|......|.|||:..||:   ..|
  Fly    84 DRDFAPNSYIRPVLLDHEDVYVISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVAN 148

  Fly   187 TDIHVIGFSLGAQV----PNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIH 247
            ..||:||||||.||    .||:.|.:.     ||||||||.||||....:.:||..||.:|||||
  Fly   149 DQIHLIGFSLGGQVAGQTANYVKRKMK-----RITGLDPAKPLFILGPDSRRLDKGDADFVDVIH 208

  Fly   248 TNALVQGKMERCGHADFYMNGGIMQPGCNGQKI-NSFACSHQRAPAYFLESIRSPKGFWGWACSG 311
            |:...:|.:...||.|||.|.|..||||..:.: :..:|:|:|||.::.|||.:..|||...|||
  Fly   209 TDVFGRGYLRAAGHVDFYPNFGAKQPGCMEENMQDPSSCNHERAPRFYAESINTTVGFWARQCSG 273

  Fly   312 YISYLLGMCPPTNFLLEAGENIRPTTRGMFMIDTNDSSPFALGKWTDL 359
            ::..||.:||.|......|.::....||.:.:.|...||:||||..|:
  Fly   274 WLLQLLTLCPTTGAQALLGYHVSDELRGSYFLQTASKSPYALGKMQDV 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 111/294 (38%)
Pancreat_lipase_like 75..347 CDD:238363 108/282 (38%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 108/281 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.