DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and CG34448

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster


Alignment Length:327 Identity:116/327 - (35%)
Similarity:161/327 - (49%) Gaps:47/327 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ITIGPCK-------W-----AIG-RSCPDPDVKYYIY---TRHNPMDRQCLHIDESLEKSNLTDS 107
            |..|.||       |     .:| :.||:..|.:::|   ||.:|:         .|:..|....
  Fly    13 IVSGFCKGENHTRGWLPEFCVVGEQKCPNSRVSFWLYTNQTRDDPI---------QLDPLNPQKD 68

  Fly   108 YFNPRYPTKIIIHGYNSDMFLHPLQQMREEYLAKADYNIIYVDWSILSPGPCYIS-AVHNTKHAG 171
            .|.||.|.||:|||:..:..|.|..::|:..|.....|:|.||:..|...|||.. ||:|.....
  Fly    69 VFQPRLPLKILIHGFIGNRNLTPNLEVRDVLLQTQPINVISVDYGTLVRWPCYYPWAVNNAPIVS 133

  Fly   172 TCTAQLVERLVETG---NTDIHVIGFSLGAQVPNYIARNLSSFMLPRITGLDPAMPLFITS-GKA 232
            .|.||::..|:..|   ..|||:|||||||||...:| |..|..|.||||||||.|.|:.. ...
  Fly   134 ECLAQMINNLISAGISRREDIHLIGFSLGAQVAGMVA-NYVSQPLARITGLDPAGPGFMMQPSLQ 197

  Fly   233 DKLDPSDASYVDVIHTNALVQGKMERCGHADFYMN-GGIMQPGCNGQKINS---FACSHQRAPAY 293
            .|||.|||.:||:|||:......:...||||||.| ..:.|.||:  .|::   :.|:|.||..|
  Fly   198 QKLDASDADFVDIIHTDPFFFSMLPPMGHADFYPNLDQLNQRGCS--YISNWRFYNCNHYRAAVY 260

  Fly   294 FLESIRSPKGFWGWACSGYISYLLGMC------PPTNFLLEAGENIRPTTRGMFMIDTNDSSPFA 352
            :.|||.|.:|||...|.|:..:....|      |.|    :.|..:.....|.:.:.|::.:|||
  Fly   261 YGESIISERGFWAQQCGGWFDFFSQRCSHYSNMPNT----QMGYFVSEDASGSYFLTTHEVAPFA 321

  Fly   353 LG 354
            .|
  Fly   322 KG 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 107/302 (35%)
Pancreat_lipase_like 75..347 CDD:238363 104/289 (36%)
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 104/287 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438296
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.