DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and PNLIP

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:499 Identity:138/499 - (27%)
Similarity:194/499 - (38%) Gaps:143/499 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WRLVIGLLLLASFNRETIGKR---FLNLKPIPIQHEDESSTEGSTNPTPTSTTTPSNRDITIGPC 64
            |.|  .|||.|...:|...:|   |          .|:|...|.|           .|.:.|.| 
Human     5 WTL--SLLLGAVAGKEVCYERLGCF----------SDDSPWSGIT-----------ERPLHILP- 45

  Fly    65 KWAIGRSCPDPDVKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIHGYNSDMFLH 129
             |    |..|.:.::.:||..||.:.|    :.:.:.|:::.|.|.....|:.||||:       
Human    46 -W----SPKDVNTRFLLYTNENPNNFQ----EVAADSSSISGSNFKTNRKTRFIIHGF------- 94

  Fly   130 PLQQMREEYLAKA--------DYNIIYVDWSILS-PGPCYISAVHNTKHAGTCTAQLVERLVET- 184
             :.:..|.:||..        ..|.|.|||...| .|  |..|..|.:..|...|..||.|... 
Human    95 -IDKGEENWLANVCKNLFKVESVNCICVDWKGGSRTG--YTQASQNIRIVGAEVAYFVEFLQSAF 156

  Fly   185 --GNTDIHVIGFSLGAQVPNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIH 247
              ..:::||||.||||.......|..:. .:.||||||||.|.|..:.:..:||||||.:|||||
Human   157 GYSPSNVHVIGHSLGAHAAGEAGRRTNG-TIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIH 220

  Fly   248 TNA------LVQGKMERCGHADFYMNGGIMQPGCNGQKINSF--------------ACSHQRAPA 292
            |:.      |..|..:..||.||:.|||:..|||....::..              ||:|.|:..
Human   221 TDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYK 285

  Fly   293 YFLESIRSPKGFWGWACSGYISYLLGMCPP-------------------TNFLLEAGENIRPTTR 338
            |:.:||.:|.||.|:.|:.|..:....|.|                   ||   :.|:.      
Human   286 YYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTN---DVGQK------ 341

  Fly   339 GMFMIDTNDSSPFALGKWTDLPTLGAKQPQWRVPTQKLKAPPNQGVDPLLHHIDQFGKLAANFNN 403
              |.:||.|:|.||..::....||..|:                    :..||     |.:.|.|
Human   342 --FYLDTGDASNFARWRYKVSVTLSGKK--------------------VTGHI-----LVSLFGN 379

  Fly   404 LQMWPTEQDPYEHWTSF----SPEQKENDSDGDSVEEQDPVEFI 443
                ......||.:...    |....|.|||.| |.:...|:||
Human   380 ----KGNSKQYEIFKGTLKPDSTHSNEFDSDVD-VGDLQMVKFI 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 99/334 (30%)
Pancreat_lipase_like 75..347 CDD:238363 95/322 (30%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 110/387 (28%)
PLAT_PL 355..465 CDD:238857 20/94 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145220
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.