DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and CG6271

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster


Alignment Length:296 Identity:95/296 - (32%)
Similarity:139/296 - (46%) Gaps:27/296 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GRSCPDPDVKYYIYTRHNPMDRQCLHI---DESLEKSNLTDSYFNPRYPTKIIIHGYNSDMFLHP 130
            ||......|.:|::|..||...:  ||   .:|:.|||     |||.:||:.:|||:........
  Fly    60 GRGLTTVPVNFYLFTPKNPSSSK--HIYATTKSISKSN-----FNPAHPTRFVIHGWTQSYLNSM 117

  Fly   131 LQQMREEYLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVETGN---TDIHVI 192
            ...:|:.:|:|.|||:|.|||: .:....|.::|......|...|:::..|.:...   .|::||
  Fly   118 NSDIRKAFLSKGDYNVIVVDWA-RARSVDYATSVMAVAATGKKVAKMINFLKDNHGLNLNDVYVI 181

  Fly   193 GFSLGAQVPNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKME 257
            |.||||.|..|..:|... .:..|.|||||:|||..:....:|:..||.||:.|.||....|.::
  Fly   182 GHSLGAHVAGYAGKNTDG-QVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLK 245

  Fly   258 RCGHADFYMNGGIMQPGC----NGQKINSFACSHQRAPAYFLESIRSPKGFWGWACSGYISYLLG 318
            ..|...||.|||..||||    .|      ||||.|:..|:.|:: |...|....|..|...:..
  Fly   246 PIGKGAFYPNGGKTQPGCPLDVTG------ACSHGRSTTYYAEAV-SEDNFGTMKCGDYEEAVAK 303

  Fly   319 MCPPTNFLLEAGENIRP-TTRGMFMIDTNDSSPFAL 353
            .|..|...:..|.:... ...|.|.:..|..:||.:
  Fly   304 ECGSTYSSVRMGADTNAYMVEGDFYVPVNSKAPFGM 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 93/292 (32%)
Pancreat_lipase_like 75..347 CDD:238363 90/282 (32%)
CG6271NP_651526.1 Lipase 57..337 CDD:278576 93/292 (32%)
Pancreat_lipase_like 68..333 CDD:238363 90/280 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445949
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.