DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and CG6295

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:305 Identity:94/305 - (30%)
Similarity:141/305 - (46%) Gaps:43/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GRSCPDPDVKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIHGYNS--DMFLHPL 131
            ||:..:| |.:|:||..|....|    :.....::::.|:|||.:||:..|||::|  |.|::  
  Fly    57 GRNVLNP-VTFYLYTNSNRNSPQ----EIKATSASISGSHFNPNHPTRFTIHGWSSSKDEFIN-- 114

  Fly   132 QQMREEYLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERL-----VETGNTDIHV 191
            ..:|:.:....|.|:|.|||. .:....|.|:|......|...|.|:..:     :...||  .|
  Fly   115 YGVRDAWFTHGDMNMIAVDWG-RARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNT--MV 176

  Fly   192 IGFSLGAQVPNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKM 256
            ||.||||.|..|..:|:.:..|..|.|||||:|||.......:|..:||.||:.|.||....|.:
  Fly   177 IGHSLGAHVSGYAGKNVKNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFL 241

  Fly   257 ERCGHADFYMNGGIMQPGCNGQKINSFACSHQRAPAYFLESIRSPKGFWGWAC------------ 309
            :..|...||.|||..||||......|  |:|.|:..|:.||: :...|....|            
  Fly   242 KPIGKGAFYPNGGKSQPGCGVDLTGS--CAHSRSVIYYAESV-TENNFPTMRCGDYEEAVAKECG 303

  Fly   310 SGYISYLLGMCPPTNFLLEAGENIRPTTRGMFMIDTNDSSPFALG 354
            |.|.|..:|  ..||..:.||:         :.:.....:|:.:|
  Fly   304 SSYSSVRMG--ATTNAYMVAGD---------YYVPVRSDAPYGMG 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 92/300 (31%)
Pancreat_lipase_like 75..347 CDD:238363 90/290 (31%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 89/288 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445951
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.