DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and sxe2

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster


Alignment Length:384 Identity:105/384 - (27%)
Similarity:160/384 - (41%) Gaps:68/384 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HWRLVIGLLLLASFNRETI--------GKRFLNLKPIPIQHEDESSTEGST---NPTPTSTTTPS 55
            ||.|...||||.:...:..        ||..:::..: ||  ...:||...   .|.|:.|..  
  Fly    11 HWLLWTCLLLLGAAGTDASVDYFAYAPGKCEVSISDV-IQ--GMITTEAGVILGRPRPSQTKL-- 70

  Fly    56 NRDITIGPCKWAIGRSCPDPDVKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIH 120
                                 ::|.:||..||.:||.|...   :.:.|.:|:|||::|.::.||
  Fly    71 ---------------------LRYDLYTPLNPEERQLLRPG---DLTMLRNSHFNPKWPVRVSIH 111

  Fly   121 GYNSDMFLHPLQQMREEYLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVETG 185
            |:...........:::.||::.:||:|.:|||..|....|..............|:::..|.:  
  Fly   112 GWAGKSVTCSNAAIKDAYLSRGNYNVIILDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLHD-- 174

  Fly   186 NT-----DIHVIGFSLGAQVPNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDV 245
            ||     .|::||.|.|:.:.....:.|....|..|..||||....::.|..::||.:||.||:.
  Fly   175 NTGVPYEQIYMIGHSAGSHISGLTGKLLRPHRLGAIFALDPAGLTQLSLGPEERLDVNDALYVES 239

  Fly   246 IHTNALVQGK-MERCGHADFYMNGGIMQPGCNGQKIN--SFACSHQRAPAYFLESIRSPKGFWGW 307
            |||:..:.|. ..:..||.|:.|.|:.||.|......  .|.|.|..|..||.||:|.||.|...
  Fly   240 IHTDLTLLGNPSTKLSHASFFANWGLGQPHCPNATATEFDFVCDHFAAMFYFAESVRQPKSFAAL 304

  Fly   308 ACS---------------GYISYLLGMCPPTNFLLEAGENIRPTTRGMFMIDTNDSSPF 351
            .||               |...|.:..|....|:  .||...| .||:|.:.|...||:
  Fly   305 RCSSAKSVLSATCNCNVGGSEKYAVNTCTGNEFM--GGEPAVP-KRGIFYLSTRPQSPY 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 88/306 (29%)
Pancreat_lipase_like 75..347 CDD:238363 87/294 (30%)
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 93/337 (28%)
Pancreat_lipase_like 72..356 CDD:238363 87/291 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446003
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.