DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and CG17292

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster


Alignment Length:320 Identity:96/320 - (30%)
Similarity:146/320 - (45%) Gaps:44/320 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SNRDITIGPCKWAIGRSCPDPDVKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIII 119
            |..|:|........|.:..|.|:       ::..|.|.|..||.|:....|..|          :
  Fly    18 SKADLTTAKFILYYGPTVADSDI-------YDLTDFQSLLEDEHLDLGKNTVLY----------L 65

  Fly   120 HGYNSDMFLHPLQQMREEYLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVET 184
            |||..|..:..:..:.|.||.:.|.|:|.:||..|:.|.....|..|.|..|...|:::.::.:.
  Fly    66 HGYLEDPDVESIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVLLKMFDH 130

  Fly   185 GNTDI---HVIGFSLGAQVPNYIARNLSS-----FMLPRITGLDPAMPLFITSGKADKLDPSDAS 241
            | .||   |::|.|:|.|:...:.|.::.     ..:.||:.||||.|||.   ....|..:||.
  Fly   131 G-LDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFY---PGTHLSANDAE 191

  Fly   242 YVDVIHTNALVQGKMERCGHADFYMNGGI-MQPGCNGQKINSFA----CSHQRAPAYFLESI--R 299
            :||||||:|.:.|.....|.|||:.|||. :||||..:.....:    .||:|:..::.||:  |
  Fly   192 FVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWWFWAESVSDR 256

  Fly   300 SPKGFWGWACSGYISY----LLGMCPPTNFLLEAGENIRPTTRGMFMIDTNDSSPFALGK 355
            .|.||.......:..:    ::..|||    :..|.:...|..|.|.:.||..:|||.||
  Fly   257 YPIGFDAVPAKKWSDFKQNKIVENCPP----VVMGHHCPTTIHGDFYLQTNGHTPFARGK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 88/302 (29%)
Pancreat_lipase_like 75..347 CDD:238363 85/290 (29%)
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 87/304 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.