DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and CG14034

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:288 Identity:110/288 - (38%)
Similarity:167/288 - (57%) Gaps:12/288 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CPDPDVKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIHGYNSDMFLHPLQQMRE 136
            ||:.::.:::||:.|....:.     |:.:.|..:.|.:.  |.|::|||:|......|..|:|.
  Fly    33 CPNANISFWLYTKENQEGTKL-----SVFELNRFEFYHHK--PLKVLIHGFNGHRDFSPNTQLRP 90

  Fly   137 EYLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVETGNT---DIHVIGFSLGA 198
            .:|.: |||:|.:|:..|:..|||..||||.|:...|||||:..|:|:|..   |:|:||..|||
  Fly    91 LFLTQ-DYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGA 154

  Fly   199 QVPNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKMERCGHAD 263
            .|..:|.:.|....|..||.||||.|.::....|.||||:||.:|||:||:..:.|.::..||.|
  Fly   155 HVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVD 219

  Fly   264 FYMNGGIMQPGCNG-QKINSFACSHQRAPAYFLESIRSPKGFWGWACSGYISYLLGMCPPTNFLL 327
            ||:|.|:.||.|.. .|:.:..|.|.||..|:.|||.||.||:|:.|..:.|:..|:|.|...:.
  Fly   220 FYLNMGVSQPNCGPINKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIPDKNIE 284

  Fly   328 EAGENIRPTTRGMFMIDTNDSSPFALGK 355
            ..|.::.|..||.:.:|||:..|:|.|:
  Fly   285 LMGFHVDPKARGRYFLDTNNGPPYAKGE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 107/282 (38%)
Pancreat_lipase_like 75..347 CDD:238363 104/275 (38%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 103/273 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.