DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and Yp3

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster


Alignment Length:282 Identity:79/282 - (28%)
Similarity:108/282 - (38%) Gaps:73/282 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 IIHGYNSDMFLHPLQ---QMREEYLAKADY--------------------NIIYVD-WSILSPGP 158
            :|..|.....|..||   |.:::.|..:||                    ::|.:| .|.|:...
  Fly   144 LIQAYVQKYNLQQLQKNAQEQQQQLKSSDYDYTSSEEAADQWKSAKAASGDLIIIDLGSTLTNFK 208

  Fly   159 CYISAVHNTKHAGTCTAQLVERLVETG--NTDIHVIGFSLGAQVP-----NYIARNLSSFMLPRI 216
            .|  |:.:..:.|....|.:..|...|  ...||:||..:.|.|.     .|.|:  :...|.||
  Fly   209 RY--AMLDVLNTGAMIGQTLIDLTNKGVPQEIIHLIGQGISAHVAGAAGNKYTAQ--TGHKLRRI 269

  Fly   217 TGLDPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKMERCGHADFYMNG---GIMQPGCNGQ 278
            ||||||..|.........|...||.:||.|||:....|...|||..|||.||   |:  || :..
  Fly   270 TGLDPAKVLSKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRCGDVDFYPNGPSTGV--PG-SEN 331

  Fly   279 KINSFACSHQRAPAYFLESIR--SPKGFWGWACSGYISYLLGMCPPTNFLLE------------A 329
            .|.:.|    ||..||.||:|  |.:.|              ...|.|.|.:            .
  Fly   332 VIEAVA----RATRYFAESVRPGSERNF--------------PAVPANSLKQYKEQDGFGKRAYM 378

  Fly   330 GENIRPTTRGMFMIDTNDSSPF 351
            |..|....||.::::.|..|||
  Fly   379 GLQIDYDLRGDYILEVNAKSPF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 77/280 (28%)
Pancreat_lipase_like 75..347 CDD:238363 75/276 (27%)
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 77/280 (28%)
Abhydrolase <215..396 CDD:304388 60/203 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438324
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.