DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and CG5966

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster


Alignment Length:398 Identity:117/398 - (29%)
Similarity:176/398 - (44%) Gaps:73/398 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLASFNRETIGKRFLNLKPIPIQHEDESSTEG--STNPT--PTSTTTPSNRDITIGPCKWAIG 69
            :|.||:..........::|.|.|....:|....|  ...|.  |.:|.|   |.|.:.|.|.:  
  Fly    15 MLYLANHTSRAAVNTLVDLPPAPKSDINEVKCFGVYGCFPINGPWNTVT---RSINVHPQKPS-- 74

  Fly    70 RSCPDPDVKYYIYTRHNPMDRQCLHID----ESLEKSNLTDSYFNPRYPTKIIIHGYNSDMFLHP 130
                :.:..:.::|| ..:| |..::|    ||::...:     ||:....:::|||.....:..
  Fly    75 ----EIEPHFTLHTR-RALD-QPKYLDLNDPESVQGMGM-----NPKGKIFLLVHGYLESGEIPW 128

  Fly   131 LQQMREEYLA---KADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVE---TGNTD- 188
            :..|.:..||   :...:::.:||. ....|.|:.||.|.:..|..||.:|..|.|   ..|.| 
  Fly   129 MWDMAKALLAHEPEGRASVVLIDWG-GGASPPYVQAVANIRLVGAITAHVVHMLYEELRLPNLDN 192

  Fly   189 IHVIGFSLGAQVPNYIARNLS-SFML--PRITGLDPAMPLFITSGKADKLDPSDASYVDVIHT-- 248
            :|:||.||||.:..|...:|. .|.|  .||||||||.|||..:....:||.:||.:||::||  
  Fly   193 VHIIGHSLGAHLSGYAGYHLQHDFGLKPARITGLDPAAPLFTDTDPIVRLDKTDAHFVDIVHTDA 257

  Fly   249 NALVQGKM---ERCGHADFYMNGGIMQPGCNGQKINS--------------FACSHQRAPAYFLE 296
            |.|::|.:   .|.||.||:.|||...|||| :|...              ..|:|.|:..||.|
  Fly   258 NPLMKGGLGINMRLGHVDFFPNGGFDNPGCN-KKFQDVVKKKTLFLTMQEFLGCNHIRSQQYFTE 321

  Fly   297 SIRSPKGFWGWACSGYISYLLGMC----PPTNFLLEAG--------ENI------RPTTRGMFMI 343
            ||.|...|.|..|..:.|:....|    .|.:..|..|        |.:      :..:.|:|.:
  Fly   322 SIGSQCPFLGITCDSFESFKDTKCTSCEEPGHTCLRMGYHSQEDYQEQVDLGQLQQGDSPGVFYL 386

  Fly   344 DTNDSSPF 351
            .|.||.||
  Fly   387 WTGDSKPF 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 99/334 (30%)
Pancreat_lipase_like 75..347 CDD:238363 97/322 (30%)
CG5966NP_572286.1 Lipase 46..394 CDD:278576 108/365 (30%)
Pancreat_lipase_like 76..390 CDD:238363 97/322 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.